CCDC14 Antibody - BSA Free

Immunohistochemistry: CCDC14 Antibody [NBP1-84183] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC14 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IIYQALCEHVQTQMSLMNDLTSKNIPNGIPAVPCHAPSHSESQATPHSSYGLCTSTPVWSLQRPPCPPKVHSEVQTDGNSQFASQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCDC14 Protein (NBP1-84183PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCDC14 Antibody - BSA Free

• coiled-coil domain containing 14
• DKFZp434L1050
• FLJ12892

Background

CCDC14 is a gene that code for a protein that has six isoforms, with lengths of 953, 753, 793, 455, 794, and 912 amino acids and weights of approximately 106, 84, 88, 51, 89, and 102 kDa respectively. Current research is being done on diseases and disorders related to this gene including ataxia and schizophrenia. CCDC14 has also been shown to have interactions with CALM1, CALM2, CALM4, EBQLN4, and MAGEA11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCDC14