Cav1.3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cav1.3 Antibody [NBP1-86684] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Cav1.3 Antibody [NBP1-86684] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Staining of human skin shows no cytoplasmic positivity in squamous epithelial cells as expected.

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cav1.3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cav1.3 Antibody - BSA Free (NBP1-86684) is a polyclonal antibody validated for use in IHC. Anti-Cav1.3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA1D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cav1.3 Protein (NBP1-86684PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cav1.3 Antibody - BSA Free

• CACH3
• CACN4
• CACN4calcium channel, neuroendocrine/brain-type, alpha 1 subunit
• CACNA1D
• CACNL1A2
• CACNL1A2voltage-dependent L-type calcium channel subunit alpha-1D
• Calcium channel, L type, alpha-1 polypeptide, isoform 2
• calcium channel, voltage-dependent, L type, alpha 1D subunit
• Cav1.3
• CCHL1A2
• CCHL1A2voltage-gated calcium channel alpha 1 subunit
• L type, alpha-1 polypeptide
• voltage-gated calcium channel alpha subunit Cav1.3
• Voltage-gated calcium channel subunit alpha Cav1.3

Background

Function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA).; Subcellular location: Membrane; Multi-pass membrane protein.; Tissue specificity: Expressed in pancreatic islets and in brain, where it has been seen in hippocampus, basal ganglia, habenula and thalamus. No expression in skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cav1.3 Antibody (NBP1-86684)(2)

Publications using NBP1-86684

• Scholl UI, Goh G, Stolting G et al. Somatic and germline CACNA1D calcium channel mutations in aldosterone-producing adenomas and primary aldosteronism. Nat Genet 2013-09-01 [PMID: 23913001]
• Zou J, Lee A, Yang J. The expression of whirlin and Cav1.3a is mutually independent in photoreceptors. Vision Res 2012-12-15 [PMID: 22892111]

Bioinformatics

• Gene Symbol: CACNA1D