Caspase-6 Antibody (6D7S2)

Western Blot: Caspase-6 Antibody (6D7S2) [NBP3-15771] - Western blot analysis of extracts of various cell lines, using Caspase-6 antibody (NBP3-15771) at 1:1000 dilution.Jurkat cells were treated by Staurosporine(1uM) at room temperature for 3 hours . Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: Caspase-6 Antibody (6D7S2) [NBP3-15771] - Immunofluorescence analysis of C6 cells using Caspase-6 antibody (NBP3-15771). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clone: 6D7S2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Caspase-6 Antibody (6D7S2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 45-162 of human Caspase-6 (P55212). GIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQA
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CASP6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Caspase-6 Antibody (6D7S2)

• Apoptotic protease Mch-2
• CASP6
• CASP-6
• caspase 6, apoptosis-related cysteine peptidase
• caspase 6, apoptosis-related cysteine protease
• Caspase6
• Caspase-6
• EC 3.4.22
• Mch2
• MCH2EC 3.4.22.59

Background

Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the initiation and execution of apoptosis. Caspase-6 is a major apoptotic executioner (1,2). It exists as a pro-domain protein and is cleaved by caspase-3 into two active subunits, an 18 kDa and a 10 kDa subunit (3). Caspase-6 cleaves among many different intracellular proteins, nuclear lamins. Lamins play a significant role in maintaining the integrity of the cell membrane, and their cleavage results in subsequent cellular breakdown and death (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CASP6