Caspase-12 Antibody [DyLight 488] Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2).
Sequence: FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CASP12 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for Caspase-12 Antibody [DyLight 488]
Background
Caspases are cysteine proteases that cleave C-terminal aspartic acid residues on their substrate molecules. This gene, CASP12, is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. In rodents, the homolog of this gene mediates apoptosis in response to endoplasmic reticulum stress. However, in humans this gene contains a polymorphism for the presence or absence of a premature stop codon. The majority of human individuals have the premature stop codon and produce a truncated non-functional protein. The read-through codon occurs primarily in individuals of African descent and carriers have endotoxin hypo-responsiveness and an increased susceptibility to severe sepsis. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for Caspase-12 Antibody (NBP3-35067G) (0)
There are no publications for Caspase-12 Antibody (NBP3-35067G).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Caspase-12 Antibody (NBP3-35067G) (0)
There are no reviews for Caspase-12 Antibody (NBP3-35067G).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Caspase-12 Antibody (NBP3-35067G) (0)