Casein Kinase 1 gamma Antibody (3D1) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Casein Kinase 1 gamma Antibody (3D1) - Azide and BSA Free (H00053944-M01) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT |
| Specificity |
CSNK1G1 - casein kinase 1, gamma 1 |
| Isotype |
IgG3 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CSNK1G1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Casein Kinase 1 gamma Antibody (3D1) - Azide and BSA Free
Background
Casein kinase I is the most abundant serine/threonine kinase in eukaryotic cell extracts. Multiple isoforms of the enzyme exist. The gamma-1 isoform is involved in growth and morphogenesis of eukaryotic cells.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Publications for Casein Kinase 1 gamma Antibody (H00053944-M01) (0)
There are no publications for Casein Kinase 1 gamma Antibody (H00053944-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Casein Kinase 1 gamma Antibody (H00053944-M01) (0)
There are no reviews for Casein Kinase 1 gamma Antibody (H00053944-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Casein Kinase 1 gamma Antibody (H00053944-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Casein Kinase 1 gamma Products
Research Areas for Casein Kinase 1 gamma Antibody (H00053944-M01)
Find related products by research area.
|
Blogs on Casein Kinase 1 gamma