Casein Kinase 1 gamma Antibody (2E10)

Images

 
Western Blot: Casein Kinase 1 gamma Antibody (2E10) [H00053944-M02] - CSNK1G1 monoclonal antibody (M02), clone 2E10 Analysis of CSNK1G1 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: Casein Kinase 1 gamma Antibody (2E10) [H00053944-M02] - Analysis of monoclonal antibody to CSNK1G1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: Casein Kinase 1 gamma Antibody (2E10) [H00053944-M02] - Detection limit for recombinant GST tagged CSNK1G1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Casein Kinase 1 gamma Antibody (2E10) Summary

Immunogen
CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT
Specificity
CSNK1G1 - casein kinase 1, gamma 1
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSNK1G1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Casein Kinase 1 gamma Antibody (2E10)

  • Casein Kinase 1 gamma
  • casein kinase 1, gamma 1
  • casein kinase I isoform gamma-1
  • CKI-gamma 1
  • CSNK1G1
  • EC 2.7.11
  • EC 2.7.11.1

Background

Casein kinase I is the most abundant serine/threonine kinase in eukaryotic cell extracts. Multiple isoforms of the enzyme exist. The gamma-1 isoform is involved in growth and morphogenesis of eukaryotic cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
NBP2-16020
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-50030
Species: Bv, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-81046
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-69095
Species: Hu, Pm, Mu
Applications: WB
AF6947
Species: Hu
Applications: WB
H00027130-P02
Species: Hu
Applications: ELISA, AP, PA, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-32002
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-40367
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB

Publications for Casein Kinase 1 gamma Antibody (H00053944-M02) (0)

There are no publications for Casein Kinase 1 gamma Antibody (H00053944-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 1 gamma Antibody (H00053944-M02) (0)

There are no reviews for Casein Kinase 1 gamma Antibody (H00053944-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Casein Kinase 1 gamma Antibody (H00053944-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Casein Kinase 1 gamma Products

Bioinformatics Tool for Casein Kinase 1 gamma Antibody (H00053944-M02)

Discover related pathways, diseases and genes to Casein Kinase 1 gamma Antibody (H00053944-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 1 gamma Antibody (H00053944-M02)

Discover more about diseases related to Casein Kinase 1 gamma Antibody (H00053944-M02).
 

Pathways for Casein Kinase 1 gamma Antibody (H00053944-M02)

View related products by pathway.

Research Areas for Casein Kinase 1 gamma Antibody (H00053944-M02)

Find related products by research area.

Blogs on Casein Kinase 1 gamma

There are no specific blogs for Casein Kinase 1 gamma, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Casein Kinase 1 gamma Antibody (2E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK1G1
Entrez
OMIM
Uniprot