CARS Antibody (7V0X1)

Western Blot: CARS Antibody (7V0X1) [NBP3-15264] - Western blot analysis of extracts of various cell lines, using CARS antibody (NBP3-15264) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry-Paraffin: CARS Antibody (7V0X1) [NBP3-15264] - Immunohistochemistry of paraffin-embedded rat brain using CARS Rabbit mAb (NBP3-15264) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clone: 7V0X1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CARS Antibody (7V0X1) Summary

• Description: Novus Biologicals Rabbit CARS Antibody (7V0X1) (NBP3-15264) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 650-748 of human CARS (P49589). EREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CARS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CARS Antibody (7V0X1)

• CARS1
• CysRS
• cysteine translase
• cysteine tRNA ligase 1, cytoplasmic
• Cysteine--tRNA ligase
• cysteinyl-tRNA synthetase
• cysteinyl-tRNA synthetase, cytoplasmic
• EC 6.1.1
• EC 6.1.1.16
• MGC:11246

Background

CARS encodes a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CARS1