CARD11/CARMA1 Recombinant Protein Antigen

Images

 
There are currently no images for CARD11/CARMA1 Recombinant Protein Antigen (NBP2-49067PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CARD11/CARMA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CARD11/CARMA1.

Source: E. coli

Amino Acid Sequence: ELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CARD11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49067.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CARD11/CARMA1 Recombinant Protein Antigen

  • BIMP3
  • BIMP3card-maguk protein 1
  • CARD11
  • CARD-containing MAGUK protein 1
  • Carma 1
  • CARMA1
  • CARMA1bcl10-interacting maguk protein 3
  • caspase recruitment domain family, member 11
  • caspase recruitment domain-containing protein 11
  • MGC133069

Background

CARD11 belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02597
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-56158
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB4368
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
AF5129
Species: Hu
Applications: WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP1-33042
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
PP-H0107B-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NB100-56704
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-37975
Species: Hu
Applications: IHC,  IHC-P
NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-49067PEP
Species: Hu
Applications: AC

Publications for CARD11/CARMA1 Recombinant Protein Antigen (NBP2-49067PEP) (0)

There are no publications for CARD11/CARMA1 Recombinant Protein Antigen (NBP2-49067PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CARD11/CARMA1 Recombinant Protein Antigen (NBP2-49067PEP) (0)

There are no reviews for CARD11/CARMA1 Recombinant Protein Antigen (NBP2-49067PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CARD11/CARMA1 Recombinant Protein Antigen (NBP2-49067PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CARD11/CARMA1 Products

Research Areas for CARD11/CARMA1 Recombinant Protein Antigen (NBP2-49067PEP)

Find related products by research area.

Blogs on CARD11/CARMA1

There are no specific blogs for CARD11/CARMA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CARD11/CARMA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD11