Recombinant Human Carboxypeptidase E/CPE Protein

Product Discontinued

Recombinant Human Carboxypeptidase E/CPE Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-115 of Human CPE partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGG

• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CPE

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carboxypeptidase E/CPE Protein

• Carboxypeptidase E
• Carboxypeptidase H
• CPE
• CPH
• CPH-1
• EC 3.4.17
• EC 3.4.17.10
• Enkephalin convertase
• Prohormone-processing carboxypeptidase

Background

This gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CPE