Recombinant Human CaMKI gamma Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CaMKI gamma Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 371-476 of Human CAMK1G partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCSSCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CAMK1G

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CaMKI gamma Protein

  • calcium/calmodulin-dependent protein kinase IG
  • calcium/calmodulin-dependent protein kinase type 1G
  • CaM kinase I gamma
  • CaM kinase IG
  • CaMKI gamma
  • CaM-KI gamma
  • caMKIG
  • CaMK-like CREB kinase III
  • CLICKIII
  • dJ272L16.1
  • EC 2.7.11
  • EC 2.7.11.17
  • VWS1CLICK III

Background

CAMK1G - calcium/calmodulin-dependent protein kinase IG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010645-M01
Species: Hu, Mu
Applications: WB, ELISA, IP
AF7899
Species: Hu
Applications: WB, IHC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-20898
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-86652
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CaMKI gamma Partial Recombinant Protein (H00057172-Q01) (0)

There are no publications for CaMKI gamma Partial Recombinant Protein (H00057172-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CaMKI gamma Partial Recombinant Protein (H00057172-Q01) (0)

There are no reviews for CaMKI gamma Partial Recombinant Protein (H00057172-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CaMKI gamma Partial Recombinant Protein (H00057172-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CaMKI gamma Products

Bioinformatics Tool for CaMKI gamma Partial Recombinant Protein (H00057172-Q01)

Discover related pathways, diseases and genes to CaMKI gamma Partial Recombinant Protein (H00057172-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CaMKI gamma Partial Recombinant Protein (H00057172-Q01)

Discover more about diseases related to CaMKI gamma Partial Recombinant Protein (H00057172-Q01).
 

Pathways for CaMKI gamma Partial Recombinant Protein (H00057172-Q01)

View related products by pathway.

PTMs for CaMKI gamma Partial Recombinant Protein (H00057172-Q01)

Learn more about PTMs related to CaMKI gamma Partial Recombinant Protein (H00057172-Q01).
 

Research Areas for CaMKI gamma Partial Recombinant Protein (H00057172-Q01)

Find related products by research area.

Blogs on CaMKI gamma

There are no specific blogs for CaMKI gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
Synapsin I Antibody
NB300-104-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CaMKI gamma Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMK1G