Calsequestrin 2 Antibody

Images

 
Western Blot: Calsequestrin 2 Antibody [H00000845-D01P] - Analysis of CASQ2 expression in transfected 293T cell line by CASQ2 polyclonal antibody.Lane 1: CASQ2 transfected lysate(46.40 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calsequestrin 2 Antibody Summary

Immunogen
CASQ2 (NP_001223.2, 1 a.a. - 399 a.a.) full-length human protein. MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
Specificity
CASQ2 - calsequestrin 2 (cardiac muscle),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASQ2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calsequestrin 2 Antibody

  • calsequestrin 2 (cardiac muscle)
  • calsequestrin 2, fast-twitch, cardiac muscle
  • Calsequestrin, cardiac muscle isoform
  • calsequestrin-2
  • FLJ26321
  • FLJ93514
  • PDIB2

Background

The protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB120-2824
Species: Hu, Mu, Rt, Po, Ca, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69229
Species: Hu
Applications: WB
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-38146
Species: Hu
Applications: IHC, IHC-P

Publications for Calsequestrin 2 Antibody (H00000845-D01P) (0)

There are no publications for Calsequestrin 2 Antibody (H00000845-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calsequestrin 2 Antibody (H00000845-D01P) (0)

There are no reviews for Calsequestrin 2 Antibody (H00000845-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calsequestrin 2 Antibody (H00000845-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calsequestrin 2 Products

Bioinformatics Tool for Calsequestrin 2 Antibody (H00000845-D01P)

Discover related pathways, diseases and genes to Calsequestrin 2 Antibody (H00000845-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calsequestrin 2 Antibody (H00000845-D01P)

Discover more about diseases related to Calsequestrin 2 Antibody (H00000845-D01P).
 

Pathways for Calsequestrin 2 Antibody (H00000845-D01P)

View related products by pathway.

PTMs for Calsequestrin 2 Antibody (H00000845-D01P)

Learn more about PTMs related to Calsequestrin 2 Antibody (H00000845-D01P).

Blogs on Calsequestrin 2

There are no specific blogs for Calsequestrin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calsequestrin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASQ2
Entrez
Uniprot