Calreticulin-2/CALR3 Antibody Summary
| Immunogen |
CALR3 (NP_659483.1, 1 a.a. - 384 a.a.) full-length human protein. MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CALR3 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Calreticulin-2/CALR3 Antibody
Background
Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum Persson et al. (2002) [PubMed 12384296].[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu
Applications: IHC, IHC-P
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Eq, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
Species: Hu
Applications: WB
Publications for Calreticulin-2/CALR3 Antibody (H00125972-B01P) (0)
There are no publications for Calreticulin-2/CALR3 Antibody (H00125972-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calreticulin-2/CALR3 Antibody (H00125972-B01P) (0)
There are no reviews for Calreticulin-2/CALR3 Antibody (H00125972-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Calreticulin-2/CALR3 Antibody (H00125972-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Calreticulin-2/CALR3 Products
Research Areas for Calreticulin-2/CALR3 Antibody (H00125972-B01P)
Find related products by research area.
|
Blogs on Calreticulin-2/CALR3