Calneuron 1 Antibody


Western Blot: Calneuron 1 Antibody [NBP1-87422] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Calneuron 1 Antibody [NBP1-87422] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells and astrocytes.
Western Blot: Calneuron 1 Antibody [NBP1-87422] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-92

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Calneuron 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHILYHAFRDHLTMKDIE
Specificity of human, mouse, rat Calneuron 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calneuron 1 Protein (NBP1-87422PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Calneuron 1 Antibody

  • CABP8
  • calcium-binding protein 8
  • calcium-binding protein CABP8
  • calneuron 1
  • Calneuron I
  • calneuron-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt, Bv, Ch, Ze
Applications: WB, ICC/IF
Species: Hu, Mu, Rt(-)
Applications: WB, ChIP, ICC/IF, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Calneuron 1 Antibody (NBP1-87422) (0)

There are no publications for Calneuron 1 Antibody (NBP1-87422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calneuron 1 Antibody (NBP1-87422) (0)

There are no reviews for Calneuron 1 Antibody (NBP1-87422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calneuron 1 Antibody (NBP1-87422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Calneuron 1 Products

Bioinformatics Tool for Calneuron 1 Antibody (NBP1-87422)

Discover related pathways, diseases and genes to Calneuron 1 Antibody (NBP1-87422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calneuron 1 Antibody (NBP1-87422)

Discover more about diseases related to Calneuron 1 Antibody (NBP1-87422).

Pathways for Calneuron 1 Antibody (NBP1-87422)

View related products by pathway.

Blogs on Calneuron 1

There are no specific blogs for Calneuron 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Calneuron 1 Antibody and receive a gift card or discount.


Gene Symbol CALN1