CALCB Antibody - BSA Free

Western Blot: CALCB Antibody [NBP2-83962] - Host: Rabbit. Target Name: CALCB. Sample Tissue: Stomach Tumor lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CALCB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CALCB Antibody - BSA Free (NBP2-83962) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CALCB. Peptide sequence: AALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALCB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CALCB Antibody - BSA Free

• calcitonin-related polypeptide beta
• FLJ30166

Background

CALCB belongs to the calcitonin family and is involved in dilating vessels. It is expressed in the nervous and endocrine system. This protein is known to have interactions with ADCYAP1, ADCYAP1R1, ADM, ADM2 and ADRB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CALCB