Home » Cadherin-10 » Cadherin-10 Peptides and Proteins » Cadherin-10 Recombinant Protein Antigen

Cadherin-10 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Cadherin-10 Protein (NBP1-87584PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Cadherin-10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH10.

Source: E.coli

Amino Acid Sequence: EVGTIIGTVMARDPDSISSPIRFSLDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTVIAAEINNPKETTRVAVFVRILDVNDNAPQFAVFYDTFVCENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDNEDNTA
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87584.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Cadherin-10 Recombinant Protein Antigen

  • CAD10
  • cadherin 10, type 2 (T2-cadherin)
  • Cadherin10
  • Cadherin-10
  • CDH10
  • T2-Cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cadherin-18
Antibody
NBP2-48527
Western Blot: Cadherin-18 Antibody [NBP2-48527] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: Cadherin-18 Antibody [NBP2-48527] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Species: Hu
Applications: WB, IHC, IHC-P
E-Cadherin
Antibody [Unconjugate
AF748
Western blot shows lysates of A431 human epithelial carcinoma cell line, A549 human lung carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, P19 mouse embryonal carcinoma cell line, and 4T1 mouse breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for E‑Cadherin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of 4T1 mouse breast cancer cell line, P19 mouse embryonal carcinoma cell line, A431 human epithelial carcinoma cell line, and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for E‑Cadherin at approximately 128 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(5 Reviews)
(25 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Cadherin-6/KCAD
Antibody [Unconjugate
AF2715
Cadherin‑6/KCAD was detected in immersion fixed MG‑63 human osteosarcoma cell line using Sheep Anti-Human Cadherin‑6/KCAD Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2715) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MG‑63 human osteosarcoma cell line was stained with Sheep Anti-Human Cadherin‑6/KCAD Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF2715, filled histogram) or control antibody (Catalog # 5-001-A, open histogram), followed by NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL010).
(1 Publication)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

M-Cadherin/Cadherin-15 ...
AF4096
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human M-Cadherin/Cadherin-15 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4096) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for M-Cadherin/Cadherin-15 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
M‑Cadherin/Cadherin-15 was detected in immersion fixed C2C12 mouse myoblast cell line using Sheep Anti-Human M‑Cadherin/Cadherin-15 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4096) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
C2C12 mouse myoblast cell line was stained with Sheep Anti-Human M‑Cadherin/Cadherin‑15 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4096, filled histogram) or control antibody (Catalog # 5-001-A, open histogram), followed by NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL010).
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Cadherin-8
188-C8
Cadherin-8
Species: Hu
Cadherin-11
Antibody (283416)
MAB1790
Cadherin‑11 was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. Specific bands were detected for Cadherin‑11 at approximately 114 & 137 kDa (as indicated) using 20 µg/mL of Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western blot shows lysates of PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Cadherin‑11 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
VE-Cadherin
Antibody [Unconjugate
AF1002
Western blot shows lysates of mouse lung tissue and bEnd.3 mouse endothelioma cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse VE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1002) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for VE‑Cadherin at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. Specific bands were detected for VE‑Cadherin at approximately 118, 146 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse VE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1002). This experiment was conducted under reducing conditions and using the 12‑230 kDa separation system.        
VE‑Cadherin was detected in immersion fixed paraffin-embedded sections of mouse heart using Goat Anti-Mouse VE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1002) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
(29 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
Cadherin-13
Antibody [Unconjugate
AF3264
Western blot shows lysates of human brain (cortex) tissue. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human Cadherin‑13 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3264) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Cadherin‑13 at approximately 105 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Cadherin‑13 was detected in immersion fixed paraffin-embedded sections of human skin using Goat Anti-Human Cadherin‑13 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3264) at 0.1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membranes of keratinocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Cadherin‑13 was detected in immersion fixed NCI-H460 human large cell lung carcinoma cell line using 10 µg/mL Goat Anti-Human Cadherin‑13 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3264) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(8 Publications)
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Cadherin-7
6774-CA
Cadherin-7
Species: Hu
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in control (vector only transfected HEK293T lysate) and CHKA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Species: Hu
Applications: WB, IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(16 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
N-Cadherin
Antibody (13A9)
NBP1-48309
Western Blot: N-Cadherin Antibody (13A9) [NBP1-48309] - Analysis of N Cadherin expression in HeLa whole cell lysate.
Immunocytochemistry/Immunofluorescence: N-Cadherin Antibody (13A9) [NBP1-48309] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-N-Cadherin Antibody (13A9) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: N-Cadherin Antibody (13A9) [NBP1-48309] - IHC analysis of N Cadherin in mouse liver using DAB with hematoxylin counterstain.
(1 Review)
(24 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Protocadherin-10
Antibody
NBP1-81410
Immunohistochemistry-Paraffin: Protocadherin-10 Antibody [NBP1-81410] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: Protocadherin-10 Antibody [NBP1-81410] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Protocadherin-10 Antibody [NBP1-81410] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Choline Kinase
beta Antibody
NBP1-85632
Immunocytochemistry/Immunofluorescence: Choline Kinase beta Antibody [NBP1-85632] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Choline Kinase beta Antibody [NBP1-85632] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC
Cadherin-19
Antibody
H00028513-B01P
Western Blot: CDH19 Antibody [H00028513-B01P] - Analysis of CDH19 expression in human colon.
Western Blot: CDH19 Antibody [H00028513-B01P] - Analysis of CDH19 expression in transfected 293T cell line by CDH19 polyclonal antibody. Lane 1: CDH19 transfected lysate(84.92 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu
Applications: WB, ELISA
BDNF [Unconjugated]
248-BD
1 μg/lane of Recombinant Human BDNF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human BDNF (Catalog #248‑BD) stimulates cell proliferation in the BaF mouse pro-B cell line transfected with TrkB. The ED50 for this effect is 0.2-2 ng/mL.
(6 Reviews)
(106 Publications)
Species: Hu, Mu, Rt, Ca, Eq
Cadherin-10
Recombinant Protein A
NBP1-87584PEP
Cadherin-10 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Cadherin-10 Protein (NBP1-87584PEP) (0)

There are no publications for Cadherin-10 Protein (NBP1-87584PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-10 Protein (NBP1-87584PEP) (0)

There are no reviews for Cadherin-10 Protein (NBP1-87584PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Cadherin-10 Protein (NBP1-87584PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Cadherin-10 Protein (NBP1-87584PEP)

Discover related pathways, diseases and genes to Cadherin-10 Protein (NBP1-87584PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-10 Protein (NBP1-87584PEP)

Discover more about diseases related to Cadherin-10 Protein (NBP1-87584PEP).
 

Pathways for Cadherin-10 Protein (NBP1-87584PEP)

View related products by pathway.

Blogs on Cadherin-10

There are no specific blogs for Cadherin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 μg/lane of Recombinant Human BDNF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
BDNF [Unconjugated]
248-BD-005
Western Blot: N-Cadherin Antibody (13A9) [NBP1-48309] - Analysis of N Cadherin expression in HeLa whole cell lysate.
N-Cadherin Antibody (13A9)
NBP1-48309
Western blot shows lysates of A431 human epithelial carcinoma cell line, A549 human lung carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, P19 mouse embryonal carcinoma cell line, and 4T1 mouse breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for E‑Cadherin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
E-Cadherin Antibody [Unconjugated]
AF748

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cadherin-10 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDH10