CACNB2 Antibody (6C1)

Images

 
Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1 Analysis of CACNB2 expression in Jurkat.
Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1. Analysis of CACNB2 expression in PC-12.
Western Blot: CACNB2 Antibody (6C1) [H00000783-M01] - CACNB2 monoclonal antibody (M01), clone 6C1. Analysis of CACNB2 expression in NIH/3T3.
ELISA: CACNB2 Antibody (6C1) [H00000783-M01] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
6C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CACNB2 Antibody (6C1) Summary

Immunogen
CACNB2 (NP_963890 213 a.a. - 301 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Specificity
CACNB2 - calcium channel, voltage-dependent, beta 2 subunit
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CACNB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CACNB2 Antibody (6C1)

  • CAB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • calcium channel, voltage-dependent, beta 2 subunit
  • CAVB2
  • FLJ23743
  • Lambert-Eaton myasthenic syndrome antigen B
  • myasthenic (Lambert-Eaton) syndrome antigen B
  • MYSB
  • voltage-dependent L-type calcium channel subunit beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5489
Species: Hu
Applications: WB, IHC
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-83984
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12907
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2864
Species: Hu, Mu, Rt, Po, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-13914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
37470002
Species: Hu
Applications: WB, ELISA
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52926
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CACNB2 Antibody (H00000783-M01) (0)

There are no publications for CACNB2 Antibody (H00000783-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNB2 Antibody (H00000783-M01) (0)

There are no reviews for CACNB2 Antibody (H00000783-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNB2 Antibody (H00000783-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNB2 Products

Bioinformatics Tool for CACNB2 Antibody (H00000783-M01)

Discover related pathways, diseases and genes to CACNB2 Antibody (H00000783-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNB2 Antibody (H00000783-M01)

Discover more about diseases related to CACNB2 Antibody (H00000783-M01).
 

Pathways for CACNB2 Antibody (H00000783-M01)

View related products by pathway.

PTMs for CACNB2 Antibody (H00000783-M01)

Learn more about PTMs related to CACNB2 Antibody (H00000783-M01).

Blogs on CACNB2

There are no specific blogs for CACNB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNB2 Antibody (6C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNB2
Entrez
OMIM
Uniprot