CACNA2D2 Antibody (3A4) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse CACNA2D2 Antibody (3A4) - Azide and BSA Free (H00009254-M05) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CACNA2D2 (NP_006021, 65 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CACNA2D2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is useful for ELISA, Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CACNA2D2 Antibody (3A4) - Azide and BSA Free
Background
This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for CACNA2D2 Antibody (H00009254-M05) (0)
There are no publications for CACNA2D2 Antibody (H00009254-M05).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CACNA2D2 Antibody (H00009254-M05) (0)
There are no reviews for CACNA2D2 Antibody (H00009254-M05).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CACNA2D2 Antibody (H00009254-M05) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CACNA2D2 Products
Blogs on CACNA2D2