CABP1 Antibody


Immunohistochemistry-Paraffin: CABP1 Antibody [NBP2-14428] Staining of human cerebellum shows distinct cytoplasmic and nuclear membranous positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CABP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GNCVKYPLRNLSRKMCQEEQTSYMVVQTSEEGLAADAELPGPLLMLAQNC AVMHNLLGPACI
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
CABP1 Protein (NBP2-14428PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CABP1 Antibody

  • CaBP1
  • calcium binding protein 1
  • calcium binding protein 5
  • calcium-binding protein 1
  • caldendrin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for CABP1 Antibody (NBP2-14428) (0)

There are no publications for CABP1 Antibody (NBP2-14428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABP1 Antibody (NBP2-14428) (0)

There are no reviews for CABP1 Antibody (NBP2-14428). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CABP1 Antibody (NBP2-14428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CABP1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CABP1 Antibody (NBP2-14428)

Discover related pathways, diseases and genes to CABP1 Antibody (NBP2-14428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CABP1 Antibody (NBP2-14428)

Discover more about diseases related to CABP1 Antibody (NBP2-14428).

Pathways for CABP1 Antibody (NBP2-14428)

View related products by pathway.

PTMs for CABP1 Antibody (NBP2-14428)

Learn more about PTMs related to CABP1 Antibody (NBP2-14428).

Blogs on CABP1

There are no specific blogs for CABP1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CABP1 Antibody and receive a gift card or discount.


Gene Symbol CABP1

Customers Who Bought This Also Bought