CABP1 Antibody

Images

 
Immunohistochemistry-Paraffin: CABP1 Antibody [NBP2-14428] Staining of human cerebellum shows distinct cytoplasmic and nuclear membranous positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CABP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNCVKYPLRNLSRKMCQEEQTSYMVVQTSEEGLAADAELPGPLLMLAQNC AVMHNLLGPACI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CABP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
CABP1 Protein (NBP2-14428PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Alternate Names for CABP1 Antibody

  • CaBP1
  • CALBRAIN
  • calcium binding protein 1
  • calcium binding protein 5
  • calcium-binding protein 1
  • caldendrin
  • HCALB_BR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
H00051475-R02
Species: Hu
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NB100-1852
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-01652
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86691
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NBP1-42820
Species: Hu, Mu, Rt, Rb
Applications: WB, B/N, IP
H00005662-B01P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP2-14428
Species: Hu
Applications: IHC, IHC-P

Publications for CABP1 Antibody (NBP2-14428) (0)

There are no publications for CABP1 Antibody (NBP2-14428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABP1 Antibody (NBP2-14428) (0)

There are no reviews for CABP1 Antibody (NBP2-14428). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CABP1 Antibody (NBP2-14428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CABP1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CABP1 Antibody (NBP2-14428)

Discover related pathways, diseases and genes to CABP1 Antibody (NBP2-14428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CABP1 Antibody (NBP2-14428)

Discover more about diseases related to CABP1 Antibody (NBP2-14428).
 

Pathways for CABP1 Antibody (NBP2-14428)

View related products by pathway.

PTMs for CABP1 Antibody (NBP2-14428)

Learn more about PTMs related to CABP1 Antibody (NBP2-14428).

Blogs on CABP1

There are no specific blogs for CABP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CABP1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-14428 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought