CABC1 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

CABC1 Partial Recombinant Protein Summary

Description
CABC1 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD
Preparation
Method
in vitro wheat germ expression system
Gene
ADCK3

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CABC1 Partial Recombinant Protein

  • aarF domain containing kinase 3
  • chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
  • chaperone, ABC1 activity of bc1 complex homolog
  • chaperone, ABC1 activity of bc1 complex like (S. pombe)
  • chaperone-ABC1 (activity of bc1 complex, S.pombe)-like
  • Chaperone-ABC1-like
  • coenzyme Q8 homolog
  • EC 2.7.11
  • EC 2.7.11.-
  • MGC4849
  • mitochondrial
  • SCAR9

Background

CABC1 - chaperone, ABC1 activity of bc1 complex like (S. pombe)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00027161-M01
Species: Hu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-88450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49563
Species: Hu
Applications: IHC
NBP2-01512
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP2-13860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000141-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13836
Species: Hu
Applications: IHC, IHC-P
NB100-534
Species: Hu
Applications: WB, IP
H00051231-T01
Species: Hu
H00000817-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13859
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00056997-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CABC1 Partial Recombinant Protein (H00056997-Q01) (0)

There are no publications for CABC1 Partial Recombinant Protein (H00056997-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABC1 Partial Recombinant Protein (H00056997-Q01) (0)

There are no reviews for CABC1 Partial Recombinant Protein (H00056997-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CABC1 Partial Recombinant Protein (H00056997-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CABC1 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for CABC1 Partial Recombinant Protein (H00056997-Q01)

Discover related pathways, diseases and genes to CABC1 Partial Recombinant Protein (H00056997-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CABC1 Partial Recombinant Protein (H00056997-Q01)

Discover more about diseases related to CABC1 Partial Recombinant Protein (H00056997-Q01).
 

Pathways for CABC1 Partial Recombinant Protein (H00056997-Q01)

View related products by pathway.

PTMs for CABC1 Partial Recombinant Protein (H00056997-Q01)

Learn more about PTMs related to CABC1 Partial Recombinant Protein (H00056997-Q01).
 

Research Areas for CABC1 Partial Recombinant Protein (H00056997-Q01)

Find related products by research area.

Blogs on CABC1

There are no specific blogs for CABC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ADCK3

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00056997-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

CABC1 Recombinant Protein
H00056997-P01-10ug
ABCA1 Antibody
NB400-105
ABCA1 Antibody
NB400-105
ABCA1 Antibody
NB400-105
CABC1 Antibody
NBP2-15659
CABC1 Antibody
NBP2-15659
CABC1 Antibody
NBP2-15659