BTNL9 Antibody

Images

 
Western Blot: BTNL9 Antibody [NBP2-83955] - Host: Rabbit. Target Name: BTNL9. Sample Type: Jurkat Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTNL9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human BTNL9. Peptide sequence: DKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSLEGFKEGGIQLRLRSS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
BTNL9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTNL9 Antibody

  • BTN3
  • BTNL9
  • butyrophilin 3
  • butyrophilin-like 9
  • butyrophilin-like protein 9
  • UNQ1900/PRO4346
  • VDLS1900

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02864
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-88509
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-90750
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00000875-M01
Species: Ba, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
1849-NK
Species: Hu
Applications: BA
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP2-02151
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF8355
Species: Hu
Applications: IHC, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
MAB342
Species: Hu
Applications: AgAct, WB
NBP2-83955
Species: Hu
Applications: WB

Publications for BTNL9 Antibody (NBP2-83955) (0)

There are no publications for BTNL9 Antibody (NBP2-83955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTNL9 Antibody (NBP2-83955) (0)

There are no reviews for BTNL9 Antibody (NBP2-83955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTNL9 Antibody (NBP2-83955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTNL9 Products

Bioinformatics Tool for BTNL9 Antibody (NBP2-83955)

Discover related pathways, diseases and genes to BTNL9 Antibody (NBP2-83955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTNL9 Antibody (NBP2-83955)

Discover more about diseases related to BTNL9 Antibody (NBP2-83955).

Blogs on BTNL9

There are no specific blogs for BTNL9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTNL9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTNL9