Recombinant Human BTK Protein

Images

 
SDS-Page: Recombinant Human BTK Protein [H00000695-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BTK Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human BTK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BTK
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BTK Protein

  • Agammaglobulinaemia tyrosine kinase
  • AGMX1
  • AGMX1MGC126262
  • AT
  • ATKIMD1
  • B-cell progenitor kinase
  • BPK
  • Bruton agammaglobulinemia tyrosine kinase
  • Bruton tyrosine kinase
  • BTK
  • dominant-negative kinase-deficient Brutons tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • IMD1
  • PSCTK1
  • tyrosine-protein kinase BTK
  • XLA
  • XLAMGC126261

Background

BTK - Bruton agammaglobulinemia tyrosine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for BTK Partial Recombinant Protein (H00000695-Q01) (0)

There are no publications for BTK Partial Recombinant Protein (H00000695-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTK Partial Recombinant Protein (H00000695-Q01) (0)

There are no reviews for BTK Partial Recombinant Protein (H00000695-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTK Partial Recombinant Protein (H00000695-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BTK Products

Bioinformatics Tool for BTK Partial Recombinant Protein (H00000695-Q01)

Discover related pathways, diseases and genes to BTK Partial Recombinant Protein (H00000695-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTK Partial Recombinant Protein (H00000695-Q01)

Discover more about diseases related to BTK Partial Recombinant Protein (H00000695-Q01).
 

Pathways for BTK Partial Recombinant Protein (H00000695-Q01)

View related products by pathway.

PTMs for BTK Partial Recombinant Protein (H00000695-Q01)

Learn more about PTMs related to BTK Partial Recombinant Protein (H00000695-Q01).
 

Research Areas for BTK Partial Recombinant Protein (H00000695-Q01)

Find related products by research area.

Blogs on BTK.

CD79b - A Signal Transduction Component of the B-cell Receptor
The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BTK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BTK
Entrez