Recombinant Human BRN3A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BRN3A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 419 of Human POU4F1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

Protein/Peptide Type
Recombinant Protein
Gene
POU4F1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRN3A Protein

  • Brain-3A
  • Brain-specific homeobox/POU domain protein 3A
  • brn-3A
  • BRN3Abrain-3A
  • FLJ13449
  • Homeobox/POU domain protein RDC-1
  • Oct-T1
  • POU class 4 homeobox 1
  • POU domain class 4, transcription factor 1
  • POU domain, class 4, transcription factor 1
  • RDC1
  • RDC-1

Background

BRN3A (POU4F1) is a class IV POU domain-containing transcription factor highly expressed in the developing sensory nervous system and in cells of the B- and T-lymphocytic lineages (Gerrero et al., 1993 [PubMed 8248179]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP1-88349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
H00005457-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for BRN3A Recombinant Protein (H00005457-P01) (0)

There are no publications for BRN3A Recombinant Protein (H00005457-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRN3A Recombinant Protein (H00005457-P01) (0)

There are no reviews for BRN3A Recombinant Protein (H00005457-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRN3A Recombinant Protein (H00005457-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRN3A Products

Bioinformatics Tool for BRN3A Recombinant Protein (H00005457-P01)

Discover related pathways, diseases and genes to BRN3A Recombinant Protein (H00005457-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN3A Recombinant Protein (H00005457-P01)

Discover more about diseases related to BRN3A Recombinant Protein (H00005457-P01).
 

Pathways for BRN3A Recombinant Protein (H00005457-P01)

View related products by pathway.

PTMs for BRN3A Recombinant Protein (H00005457-P01)

Learn more about PTMs related to BRN3A Recombinant Protein (H00005457-P01).

Blogs on BRN3A

There are no specific blogs for BRN3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BRN3A Antibody (7B4)
H00005457-M04
BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRN3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU4F1