Recombinant Human Blood group H inhibitor GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Blood group H inhibitor GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-365 of Human FUT1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FUT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
67.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Blood group H inhibitor GST (N-Term) Protein

  • alpha (1,2) fucosyltransferase
  • Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase
  • Blood group H alpha 2-fucosyltransferase
  • EC 2.4.1.69
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
  • Fucosyltransferase 1
  • galactoside 2-alpha-L-fucosyltransferase 1
  • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
  • HHH
  • HSC

Background

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

464-SH/CF
Species: Mu
Applications: BA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-06699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-06699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
255-SC/CF
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
AF1705
Species: Mu
Applications: IHC, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Blood group H inhibitor Recombinant Protein (H00002523-P01) (0)

There are no publications for Blood group H inhibitor Recombinant Protein (H00002523-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blood group H inhibitor Recombinant Protein (H00002523-P01) (0)

There are no reviews for Blood group H inhibitor Recombinant Protein (H00002523-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blood group H inhibitor Recombinant Protein (H00002523-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Blood group H inhibitor Products

Bioinformatics Tool for Blood group H inhibitor Recombinant Protein (H00002523-P01)

Discover related pathways, diseases and genes to Blood group H inhibitor Recombinant Protein (H00002523-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blood group H inhibitor Recombinant Protein (H00002523-P01)

Discover more about diseases related to Blood group H inhibitor Recombinant Protein (H00002523-P01).
 

Pathways for Blood group H inhibitor Recombinant Protein (H00002523-P01)

View related products by pathway.

PTMs for Blood group H inhibitor Recombinant Protein (H00002523-P01)

Learn more about PTMs related to Blood group H inhibitor Recombinant Protein (H00002523-P01).

Blogs on Blood group H inhibitor

There are no specific blogs for Blood group H inhibitor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Blood group H inhibitor GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT1