Biliverdin Reductase A/BLVRA Antibody (4G4-2B6)

Images

 
Western Blot: Biliverdin Reductase A/BLVRA Antibody (4G4-2B6) [H00000644-M01] - Analysis of BLVRA expression in transfected 293T cell line by BLVRA monoclonal antibody (M01), clone 4G4-2B6.Lane 1: BLVRA transfected ...read more
Western Blot: Biliverdin Reductase A/BLVRA Antibody (4G4-2B6) [H00000644-M01] - BLVRA monoclonal antibody (M01), clone 4G4-2B6. Analysis of BLVRA expression in HeLa.
Western Blot: Biliverdin Reductase A/BLVRA Antibody (4G4-2B6) [H00000644-M01] - BLVRA monoclonal antibody (M01), clone 4G4-2B6 Analysis of BLVRA expression in 293.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G4-2B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Biliverdin Reductase A/BLVRA Antibody (4G4-2B6) Summary

Immunogen
BLVRA (AAH08456, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Specificity
BLVRA - biliverdin reductase A
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BLVRA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Biliverdin Reductase A/BLVRA Antibody (4G4-2B6)

  • Biliverdin Reductase A
  • Biliverdin-IX alpha-reductase
  • BLVR
  • BLVRA
  • BVR A
  • BVR
  • BVRA
  • EC 1.3.1.24

Background

Biliverdin reductases, such as BLVRA (EC 1.3.1.24), catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH (Komuro et al., 1996 [PubMed 8950184]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31341
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, S-ELISA, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01407
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
210-TA
Species: Hu
Applications: BA
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NBP3-03338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00000644-M01
Species: Hu
Applications: WB, ELISA

Publications for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01) (0)

There are no publications for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01) (0)

There are no reviews for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Biliverdin Reductase A/BLVRA Products

Bioinformatics Tool for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01)

Discover related pathways, diseases and genes to Biliverdin Reductase A/BLVRA Antibody (H00000644-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01)

Discover more about diseases related to Biliverdin Reductase A/BLVRA Antibody (H00000644-M01).
 

Pathways for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01)

View related products by pathway.

Research Areas for Biliverdin Reductase A/BLVRA Antibody (H00000644-M01)

Find related products by research area.

Blogs on Biliverdin Reductase A/BLVRA

There are no specific blogs for Biliverdin Reductase A/BLVRA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Biliverdin Reductase A/BLVRA Antibody (4G4-2B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol BLVRA
Entrez
OMIM
Uniprot