beta Adducin Recombinant Protein Antigen

Images

 
There are currently no images for beta Adducin Protein (NBP2-33975PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

beta Adducin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADD2.

Source: E. coli

Amino Acid Sequence: LLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33975.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for beta Adducin Recombinant Protein Antigen

  • ADDBErythrocyte adducin subunit beta
  • adducin 2 (beta)
  • beta adducin
  • beta-adducin

Background

Adducins are a family of cytoskeleton proteins encoded by three genes (alpha, beta and gamma). Adducin is a protein associated with the inner leaflet of the plasma membrane and is one of the proteins localized at the spectrin-actin junction of the membrane skeleton. The cortical actin cytoskeletal network is lost during apoptosis and adducins are central in the cortical actin network organization. Adducin alpha is a cytoskeletal protein involved with sodium-pump activity in the renal tubule and is associated with hypertension. The expression of Adducin alpha and Adducin gamma is ubiquitous in contrast to the restricted expression of Adducin beta. Adducin beta is expressed at high levels in brain and hematopoietic tissues, such as bone marrow in humans, and spleen in mice.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38268
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-34017
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF-252-PB
Species: Hu
Applications: IHC, WB
NBP1-82685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB2688
Species: Hu
Applications: WB
MAB1228
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBL1-11414
Species: Hu
Applications: WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
AF3697
Species: Hu
Applications: WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB

Publications for beta Adducin Protein (NBP2-33975PEP) (0)

There are no publications for beta Adducin Protein (NBP2-33975PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta Adducin Protein (NBP2-33975PEP) (0)

There are no reviews for beta Adducin Protein (NBP2-33975PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for beta Adducin Protein (NBP2-33975PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional beta Adducin Products

Research Areas for beta Adducin Protein (NBP2-33975PEP)

Find related products by research area.

Blogs on beta Adducin

There are no specific blogs for beta Adducin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our beta Adducin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADD2