Beta 2 Adaptin Antibody

Images

 
Immunohistochemistry-Paraffin: Beta 2 Adaptin Antibody [NBP2-68864] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Beta 2 Adaptin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP2B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
Beta 2 Adaptin Recombinant Protein Antigen (NBP2-68864PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Beta 2 Adaptin Antibody

  • Adapter-related protein complex 2 beta subunit
  • Adaptor protein complex AP-2 subunit beta
  • adaptor-related protein complex 2, beta 1 subunit
  • ADTB2adaptin, beta 2 (beta)
  • AP105B
  • AP2-BETA
  • beta-2-adaptin
  • beta-adaptin
  • CLAPB1AP-2 complex subunit beta
  • Clathrin assembly protein complex 2 beta large chain
  • clathrin-associated/assembly/adaptor protein, large, beta 1
  • DKFZp781K0743
  • Plasma membrane adaptor HA2/AP2 adaptin beta subunit

Background

Clathrin-mediated endocytosis is the pathway by which many receptors for nutrients and hormones are internalized to be recycled or down-regulated. During formation of clathrin coated membranes, clathrin co-assembles with heterotetrameric molecules known as assembly polypeptides (APs) or adaptors which form a layer of protein coat between the clathrin lattice and the membrane. There are two characterized adaptors AP1 and AP2. AP1 is associated with clathrin coated vesicles at the trans-Golgi network and AP2 is associated with the endocytic clathrin coated vesicles at the plasma membrane and has been shown to specifically interact with Shc and EGF receptor. AP2 is composed of four subunits, two separate 100 kDa gene products with similar domain structures (alpha and beta adaptin) and a 50 and 17 kDa subunit. There are two alpha-adaptin genes, alpha A and alpha C which have a tissue specific pattern of expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15578
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP2-00834
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Beta 2 Adaptin Antibody (NBP2-68864) (0)

There are no publications for Beta 2 Adaptin Antibody (NBP2-68864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta 2 Adaptin Antibody (NBP2-68864) (0)

There are no reviews for Beta 2 Adaptin Antibody (NBP2-68864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Beta 2 Adaptin Antibody (NBP2-68864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Beta 2 Adaptin Products

Bioinformatics Tool for Beta 2 Adaptin Antibody (NBP2-68864)

Discover related pathways, diseases and genes to Beta 2 Adaptin Antibody (NBP2-68864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beta 2 Adaptin Antibody (NBP2-68864)

Discover more about diseases related to Beta 2 Adaptin Antibody (NBP2-68864).
 

Pathways for Beta 2 Adaptin Antibody (NBP2-68864)

View related products by pathway.

Blogs on Beta 2 Adaptin

There are no specific blogs for Beta 2 Adaptin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Beta 2 Adaptin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2B1