beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human placenta, prostate, skeletal muscle and testis using Anti-B4GALT1 antibody NBP1-88655 (A) shows similar protein distribution across tissues to independent antibody NBP1-88654 (B).

Immunocytochemistry/Immunofluorescence: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human cell line HeLa shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: B4GALT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  beta-1,4-Galactosyltransferase 1/B4GalT1 Protein (NBP1-88655PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody - BSA Free

• 1,4- galactosyltransferase, polypeptide 1
• B4GalT1
• B4GAL-T1
• beta-1,4-galactosyltransferase 1
• Beta-1,4-GalTase 1
• beta4Gal-T1
• betaGlcNAc beta
• CDG2D
• EC 2.4.1
• GGTB2
• GGTB2DKFZp686N19253
• glycoprotein-4-beta-galactosyltransferase 2
• GT1
• GTB
• lactose synthase
• MGC50983
• UDP-Gal
• UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1
• UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1

Background

B4GALT1 - UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: B4GALT1