beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human cell line HeLa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human lateral ventricle shows strong granular cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B4GALT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
beta-1,4-Galactosyltransferase 1/B4GalT1 Protein (NBP1-88655PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody

  • 1,4- galactosyltransferase, polypeptide 1
  • B4GalT1
  • B4GAL-T1
  • beta-1,4-galactosyltransferase 1
  • Beta-1,4-GalTase 1
  • beta4Gal-T1
  • betaGlcNAc beta
  • CDG2D
  • EC 2.4.1
  • GGTB2
  • GGTB2DKFZp686N19253
  • glycoprotein-4-beta-galactosyltransferase 2
  • GT1
  • GTB
  • lactose synthase
  • MGC50983
  • UDP-Gal
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-35006
Species: Hu
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88655
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655) (0)

There are no publications for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655) (0)

There are no reviews for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-1,4-Galactosyltransferase 1/B4GalT1 Products

Bioinformatics Tool for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655)

Discover related pathways, diseases and genes to beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655)

Discover more about diseases related to beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655).
 

Pathways for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655)

View related products by pathway.

PTMs for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655)

Learn more about PTMs related to beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655).
 

Research Areas for beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody (NBP1-88655)

Find related products by research area.

Blogs on beta-1,4-Galactosyltransferase 1/B4GalT1

There are no specific blogs for beta-1,4-Galactosyltransferase 1/B4GalT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT1
Entrez