Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody

Images

 
Western Blot: Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody [NBP1-55107] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody Summary

Immunogen
Synthetic peptides corresponding to B3GNT4(UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) The peptide sequence was selected from the N terminal of B3GNT4. Peptide sequence MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GNT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against B3GNT4 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody

  • B3GNT4
  • B3GN-T4
  • beta-1,3-Gn-T4
  • Beta-1,3-N-acetylglucosaminyltransferase 4
  • beta-1,3-N-acetylglucosaminyltransferase bGn-T4
  • beta3Gn-T4
  • BGnT-4
  • EC 2.4.1.-
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4

Background

B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007357-M03
Species: Hu
Applications: ELISA, WB
NBP2-45527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PAGE, WB
NBP2-49661
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5968
Species: Hu
Applications: IP, WB
NBP1-91875
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-88781
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88953
Species: Hu
Applications: IHC, IHC-P
NBP1-05034
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF5768
Species: Hu
Applications: IHC, IP, Simple Western, WB
NBP2-49211
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB

Publications for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107) (0)

There are no publications for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107) (0)

There are no reviews for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Products

Bioinformatics Tool for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107)

Discover related pathways, diseases and genes to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107)

Discover more about diseases related to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107).
 

Pathways for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107)

View related products by pathway.

PTMs for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107)

Learn more about PTMs related to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP1-55107).

Blogs on Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4

There are no specific blogs for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT4
Uniprot