BCKDHB Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCKDHB Source: E. coli
Amino Acid Sequence: TIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDAL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
BCKDHB |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17345. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for BCKDHB Recombinant Protein Antigen
Background
Branched-chain keto acid dehydrogenase is a multienzyme complex associated with the inner membrane of mitochondria, andfunctions in the catabolism of branched-chain amino acids. The complex consists of multiple copies of 3 components:branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).This gene encodes the E1 beta subunit, and mutations therein have been associated with maple syrup urine disease(MSUD), type 1B, a disease characterized by a maple syrup odor to the urine in addition to mental and physicalretardation, and feeding problems. Alternative splicing at this locus results in transcript variants with different3' non-coding regions, but encoding the same isoform. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Ch, Hu, Mu(-), Po, Rt, Xp
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: AC
Publications for BCKDHB Recombinant Protein Antigen (NBP3-17345PEP) (0)
There are no publications for BCKDHB Recombinant Protein Antigen (NBP3-17345PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BCKDHB Recombinant Protein Antigen (NBP3-17345PEP) (0)
There are no reviews for BCKDHB Recombinant Protein Antigen (NBP3-17345PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for BCKDHB Recombinant Protein Antigen (NBP3-17345PEP) (0)
Additional BCKDHB Products
Research Areas for BCKDHB Recombinant Protein Antigen (NBP3-17345PEP)
Find related products by research area.
|
Blogs on BCKDHB