BCKDHB Recombinant Protein Antigen

Images

 
There are currently no images for BCKDHB Protein (NBP1-86326PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BCKDHB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCKDHB.

Source: E. coli

Amino Acid Sequence: QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCKDHB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86326.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BCKDHB Recombinant Protein Antigen

  • 2-oxoisovalerate dehydrogenase beta subunit
  • 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
  • BCKDE1B
  • BCKDH E1-beta
  • branched chain alpha-ketoacid dehydrogenase E1-beta subunit
  • branched chain keto acid dehydrogenase E1, beta polypeptide
  • Branched-chain alpha-keto acid dehydrogenase E1 component beta chain
  • dJ279A18.1
  • E1B
  • E1b-beta subunit of the branched-chain complex
  • EC 1.2.4.4
  • FLJ17880

Background

Branched-chain keto acid dehydrogenase is a multienzyme complex associated with the inner membrane of mitochondria, andfunctions in the catabolism of branched-chain amino acids. The complex consists of multiple copies of 3 components:branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).This gene encodes the E1 beta subunit, and mutations therein have been associated with maple syrup urine disease(MSUD), type 1B, a disease characterized by a maple syrup odor to the urine in addition to mental and physicalretardation, and feeding problems. Alternative splicing at this locus results in transcript variants with different3' non-coding regions, but encoding the same isoform. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-84943
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB100-56150
Species: Ch, Hu, Mu(-), Po, Rt, Xp
Applications: IHC,  IHC-P, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-79616
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB7650
Species: Mu
Applications: IHC, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86326PEP
Species: Hu
Applications: AC

Publications for BCKDHB Protein (NBP1-86326PEP) (0)

There are no publications for BCKDHB Protein (NBP1-86326PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCKDHB Protein (NBP1-86326PEP) (0)

There are no reviews for BCKDHB Protein (NBP1-86326PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BCKDHB Protein (NBP1-86326PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BCKDHB Products

Research Areas for BCKDHB Protein (NBP1-86326PEP)

Find related products by research area.

Blogs on BCKDHB

There are no specific blogs for BCKDHB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BCKDHB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCKDHB