BBX Recombinant Protein Antigen

Images

 
There are currently no images for BBX Protein (NBP2-47542PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BBX Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BBX.

Source: E.coli

Amino Acid Sequence: NSLPQYSPVTFDRKCVPVPRKKKKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHKVKNIPSIFNTPEPTTTQEPLVGSQKRKARKTKI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BBX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47542.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BBX Recombinant Protein Antigen

  • bobby sox homolog (Drosophila)
  • Bobby sox homolog
  • HBP2HSPC339
  • HMG box transcription factor BBX
  • HMG box-containing protein 2
  • MDS001
  • x 001 protein

Background

Transcription factor that is necessary for cell cycle progression from G1 to S phase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41539
Species: Mu
Applications: ICC/IF, WB
H00026959-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2200
Species: Hu
Applications: IP, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14977
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00007884-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-83289
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
H00030008-B01P
Species: Hu
Applications: Flow, WB
NBP1-33050
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-15229
Species: Hu
Applications: WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP2-47542PEP
Species: Hu
Applications: AC

Publications for BBX Protein (NBP2-47542PEP) (0)

There are no publications for BBX Protein (NBP2-47542PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBX Protein (NBP2-47542PEP) (0)

There are no reviews for BBX Protein (NBP2-47542PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BBX Protein (NBP2-47542PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BBX Products

Array NBP2-47542PEP

Bioinformatics Tool for BBX Protein (NBP2-47542PEP)

Discover related pathways, diseases and genes to BBX Protein (NBP2-47542PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBX Protein (NBP2-47542PEP)

Discover more about diseases related to BBX Protein (NBP2-47542PEP).

Blogs on BBX

There are no specific blogs for BBX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BBX Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BBX