Recombinant Human BAZ2A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BAZ2A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1681-1780 of Human BAZ2A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYSLNFSEGDGRRRRVLLKGRESPAAGPRYSEERLSPSKRRRLSMRNHHSDLTFCEIILM

Protein/Peptide Type
Partial Recombinant Protein
Gene
BAZ2A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAZ2A Protein

  • bromodomain adjacent to zinc finger domain protein 2A
  • bromodomain adjacent to zinc finger domain, 2A
  • DKFZp781B109
  • FLJ45876
  • hWALp3
  • KIAA0314FLJ13768
  • Tip5
  • TIP5FLJ13780
  • Transcription termination factor I-interacting protein 5
  • TTF-I interacting peptide 5
  • TTF-I-interacting protein 5
  • WALp3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-55310
Species: Hu, Mu
Applications: WB, IP
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB100-61041
Species: Hu
Applications: WB, IP
NB600-279
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl

Publications for BAZ2A Partial Recombinant Protein (H00011176-Q01) (0)

There are no publications for BAZ2A Partial Recombinant Protein (H00011176-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAZ2A Partial Recombinant Protein (H00011176-Q01) (0)

There are no reviews for BAZ2A Partial Recombinant Protein (H00011176-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAZ2A Partial Recombinant Protein (H00011176-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAZ2A Products

Bioinformatics Tool for BAZ2A Partial Recombinant Protein (H00011176-Q01)

Discover related pathways, diseases and genes to BAZ2A Partial Recombinant Protein (H00011176-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAZ2A Partial Recombinant Protein (H00011176-Q01)

Discover more about diseases related to BAZ2A Partial Recombinant Protein (H00011176-Q01).
 

Pathways for BAZ2A Partial Recombinant Protein (H00011176-Q01)

View related products by pathway.

PTMs for BAZ2A Partial Recombinant Protein (H00011176-Q01)

Learn more about PTMs related to BAZ2A Partial Recombinant Protein (H00011176-Q01).

Blogs on BAZ2A

There are no specific blogs for BAZ2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BAZ2A Antibody
NBP2-59158
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAZ2A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAZ2A