Recombinant Human BARHL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BARHL2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 145 - 234 of Human BARHL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BARHL2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BARHL2 Protein

  • BarH (Drosophila)-like 2
  • barH-like 2 homeobox protein
  • BarH-like homeobox 2

Background

BARHL2 - BarH-like 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86513
Species: Hu
Applications: IHC, IHC-P
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00338917-T01
Species: Hu
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
AF8218
Species: Hu
Applications: WB, IHC
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt

Publications for BARHL2 Partial Recombinant Protein (H00343472-Q01) (0)

There are no publications for BARHL2 Partial Recombinant Protein (H00343472-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BARHL2 Partial Recombinant Protein (H00343472-Q01) (0)

There are no reviews for BARHL2 Partial Recombinant Protein (H00343472-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BARHL2 Partial Recombinant Protein (H00343472-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BARHL2 Products

Bioinformatics Tool for BARHL2 Partial Recombinant Protein (H00343472-Q01)

Discover related pathways, diseases and genes to BARHL2 Partial Recombinant Protein (H00343472-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARHL2 Partial Recombinant Protein (H00343472-Q01)

Discover more about diseases related to BARHL2 Partial Recombinant Protein (H00343472-Q01).
 

Pathways for BARHL2 Partial Recombinant Protein (H00343472-Q01)

View related products by pathway.

PTMs for BARHL2 Partial Recombinant Protein (H00343472-Q01)

Learn more about PTMs related to BARHL2 Partial Recombinant Protein (H00343472-Q01).

Blogs on BARHL2

There are no specific blogs for BARHL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BARHL2 Antibody
NBP2-32013

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BARHL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BARHL2