BARHL2 Antibody


Immunohistochemistry-Paraffin: BARHL2 Antibody [NBP2-32013] - Staining of human rectum shows moderate nuclear and luminal membranous positivity in glandular cells.

Product Details

Product Discontinued
View other related BARHL2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BARHL2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: YHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRVLIHGLGPGGQPALNPLSSPI
Specificity of human, mouse BARHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.IHC-Frozen reactivity reported in (PMID: 27223328)
Read Publications using
NBP2-32013 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27223328)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BARHL2 Antibody

  • BarH (Drosophila)-like 2
  • barH-like 2 homeobox protein
  • BarH-like homeobox 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC/IF, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt

Publications for BARHL2 Antibody (NBP2-32013)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, IHC-Fr.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for BARHL2 Antibody (NBP2-32013) (0)

There are no reviews for BARHL2 Antibody (NBP2-32013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BARHL2 Antibody (NBP2-32013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BARHL2 Products

Bioinformatics Tool for BARHL2 Antibody (NBP2-32013)

Discover related pathways, diseases and genes to BARHL2 Antibody (NBP2-32013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARHL2 Antibody (NBP2-32013)

Discover more about diseases related to BARHL2 Antibody (NBP2-32013).

Pathways for BARHL2 Antibody (NBP2-32013)

View related products by pathway.

PTMs for BARHL2 Antibody (NBP2-32013)

Learn more about PTMs related to BARHL2 Antibody (NBP2-32013).

Blogs on BARHL2

There are no specific blogs for BARHL2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BARHL2 Antibody and receive a gift card or discount.


Gene Symbol BARHL2