BARHL2 Antibody

Product Discontinued

BARHL2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRVLIHGLGPGGQPALNPLSSPI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BARHL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.IHC-Frozen reactivity reported in (PMID: 27223328)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27223328)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BARHL2 Antibody

• BarH (Drosophila)-like 2
• barH-like 2 homeobox protein
• BarH-like homeobox 2

Background

BARHL2 - BarH-like 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BARHL2 Antibody (NBP2-32013)(3)

Publications using NBP2-32013

• Tulloch AJ, Teo S, Carvajal BV et al. Diverse spinal commissural neuron populations revealed by fate mapping and molecular profiling using a novel Robo3Cre mouse J. Comp. Neurol. 2019-06-01 [PMID: 31152445]
• Junge HJ, Yung AR, Goodrich LV, Chen Z. Netrin1/DCC signaling promotes neuronal migration in the dorsal spinal cord. Neural Dev. 2016-10-26 [PMID: 27784329] (IF/IHC, Mouse)
• Leggere JC, Saito Y, Darnell RB et al. NOVA regulate Dcc alternative splicing during neuronal migration and axon guidance in the spinal cord. Elife. 2016-05-25 [PMID: 27223328] (IHC-Fr, Mouse)

Bioinformatics

• Gene Symbol: BARHL2
• Uniprot:
  • Q9NY43(Human)