BARHL2 Antibody

Images

 
Immunohistochemistry-Paraffin: BARHL2 Antibody [NBP2-32013] - Staining of human rectum shows moderate nuclear and luminal membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BARHL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRVLIHGLGPGGQPALNPLSSPI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BARHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BARHL2 Protein (NBP2-32013PEP)
Publications
Read Publications using
NBP2-32013 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27223328)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BARHL2 Antibody

  • BarH (Drosophila)-like 2
  • barH-like 2 homeobox protein
  • BarH-like homeobox 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86513
Species: Hu
Applications: IHC, IHC-P
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00338917-T01
Species: Hu
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
AF8218
Species: Hu
Applications: WB, IHC
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt

Publications for BARHL2 Antibody (NBP2-32013)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, IHC-Fr.


Filter By Application
IHC
(1)
IHC-Fr
(1)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for BARHL2 Antibody (NBP2-32013) (0)

There are no reviews for BARHL2 Antibody (NBP2-32013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BARHL2 Antibody (NBP2-32013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BARHL2 Products

Bioinformatics Tool for BARHL2 Antibody (NBP2-32013)

Discover related pathways, diseases and genes to BARHL2 Antibody (NBP2-32013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARHL2 Antibody (NBP2-32013)

Discover more about diseases related to BARHL2 Antibody (NBP2-32013).
 

Pathways for BARHL2 Antibody (NBP2-32013)

View related products by pathway.

PTMs for BARHL2 Antibody (NBP2-32013)

Learn more about PTMs related to BARHL2 Antibody (NBP2-32013).

Blogs on BARHL2

There are no specific blogs for BARHL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BARHL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BARHL2
Uniprot