BAP29 Antibody


Western Blot: BAP29 Antibody [NBP1-90009] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG Lane 4: Human Plasma Lane 5: Human liver tissue. more
Immunohistochemistry-Paraffin: BAP29 Antibody [NBP1-90009] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: BAP29 Antibody [NBP1-90009] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BAP29 Antibody [NBP1-90009] - Staining in human testis and pancreas tissues using anti-BCAP29 antibody. Corresponding BCAP29 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

BAP29 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAE
Specificity of human BAP29 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BAP29 Protein (NBP1-90009PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BAP29 Antibody

  • Bap29
  • BAP29DKFZp686M2086
  • B-cell receptor-associated protein 29
  • BCR-associated protein 29
  • FLJ53907


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for BAP29 Antibody (NBP1-90009) (0)

There are no publications for BAP29 Antibody (NBP1-90009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAP29 Antibody (NBP1-90009) (0)

There are no reviews for BAP29 Antibody (NBP1-90009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAP29 Antibody (NBP1-90009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BAP29 Products

Bioinformatics Tool for BAP29 Antibody (NBP1-90009)

Discover related pathways, diseases and genes to BAP29 Antibody (NBP1-90009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAP29 Antibody (NBP1-90009)

Discover more about diseases related to BAP29 Antibody (NBP1-90009).

Pathways for BAP29 Antibody (NBP1-90009)

View related products by pathway.

Research Areas for BAP29 Antibody (NBP1-90009)

Find related products by research area.

Blogs on BAP29

There are no specific blogs for BAP29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BAP29 Antibody and receive a gift card or discount.


Gene Symbol BCAP29