Recombinant Human BANF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BANF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32509 of Human BANF1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BANF1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BANF1 Protein

  • BAFMGC111161
  • barrier to autointegration factor 1
  • barrier-to-autointegration factor
  • BCRG1
  • BCRP1
  • Breakpoint cluster region protein 1
  • D14S1460

Background

BANF1( AAH05942, 1 a.a. - 90 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for BANF1 Recombinant Protein (H00008815-P01) (0)

There are no publications for BANF1 Recombinant Protein (H00008815-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BANF1 Recombinant Protein (H00008815-P01) (0)

There are no reviews for BANF1 Recombinant Protein (H00008815-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BANF1 Recombinant Protein (H00008815-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BANF1 Products

Bioinformatics Tool for BANF1 Recombinant Protein (H00008815-P01)

Discover related pathways, diseases and genes to BANF1 Recombinant Protein (H00008815-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BANF1 Recombinant Protein (H00008815-P01)

Discover more about diseases related to BANF1 Recombinant Protein (H00008815-P01).
 

Pathways for BANF1 Recombinant Protein (H00008815-P01)

View related products by pathway.

PTMs for BANF1 Recombinant Protein (H00008815-P01)

Learn more about PTMs related to BANF1 Recombinant Protein (H00008815-P01).
 

Research Areas for BANF1 Recombinant Protein (H00008815-P01)

Find related products by research area.

Blogs on BANF1

There are no specific blogs for BANF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BANF1 Antibody (M2)
H00008815-M07
Brg1 Antibody
NB100-2594

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BANF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BANF1