BANF1 Antibody (M1)

Images

 
There are currently no images for BANF1 Antibody (H00008815-M05).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
M1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BANF1 Antibody (M1) Summary

Immunogen
BANF1 (AAH05942, 1 a.a. - 89 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Specificity
BANF1 - barrier to autointegration factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BANF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BANF1 Antibody (M1)

  • BAFMGC111161
  • barrier to autointegration factor 1
  • barrier-to-autointegration factor
  • BCRG1
  • BCRP1
  • Breakpoint cluster region protein 1
  • D14S1460

Background

The protein encoded by this gene was identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The endogenous function of the protein is unknown. The protein forms a homodimer which localizes to the nucleus and is specifically associated with chromosomes during mitosis. This protein binds to DNA in a non-specific manner and studies in rodents suggest that it also binds to lamina-associated polypeptide 2, a component of the nuclear lamina.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for BANF1 Antibody (H00008815-M05) (0)

There are no publications for BANF1 Antibody (H00008815-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BANF1 Antibody (H00008815-M05) (0)

There are no reviews for BANF1 Antibody (H00008815-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BANF1 Antibody (H00008815-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BANF1 Products

Bioinformatics Tool for BANF1 Antibody (H00008815-M05)

Discover related pathways, diseases and genes to BANF1 Antibody (H00008815-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BANF1 Antibody (H00008815-M05)

Discover more about diseases related to BANF1 Antibody (H00008815-M05).
 

Pathways for BANF1 Antibody (H00008815-M05)

View related products by pathway.

PTMs for BANF1 Antibody (H00008815-M05)

Learn more about PTMs related to BANF1 Antibody (H00008815-M05).
 

Research Areas for BANF1 Antibody (H00008815-M05)

Find related products by research area.

Blogs on BANF1

There are no specific blogs for BANF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BANF1 Antibody (M1) and receive a gift card or discount.

Bioinformatics

Gene Symbol BANF1
Entrez
OMIM
Uniprot