BAG3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BAG3 Antibody [NBP1-86442] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: BAG3 Antibody [NBP1-86442] - Staining of human oral mucosa shows strong positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAG3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BAG3 Protein (NBP1-86442PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAG3 Antibody

  • BAG family molecular chaperone regulator 3
  • BAG-3
  • BAG-family molecular chaperone regulator-3
  • Bcl-2-associated athanogene 3
  • BCL2-associated athanogene 3
  • BCL2-binding athanogene 3
  • Bcl-2-binding protein Bis
  • BIS
  • CAIR-1
  • Docking protein CAIR-1
  • MGC104307

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NB100-56696
Species: Hu
Applications: WB, Flow
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86442
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for BAG3 Antibody (NBP1-86442) (0)

There are no publications for BAG3 Antibody (NBP1-86442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAG3 Antibody (NBP1-86442) (0)

There are no reviews for BAG3 Antibody (NBP1-86442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BAG3 Antibody (NBP1-86442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAG3 Products

Bioinformatics Tool for BAG3 Antibody (NBP1-86442)

Discover related pathways, diseases and genes to BAG3 Antibody (NBP1-86442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAG3 Antibody (NBP1-86442)

Discover more about diseases related to BAG3 Antibody (NBP1-86442).
 

Pathways for BAG3 Antibody (NBP1-86442)

View related products by pathway.

PTMs for BAG3 Antibody (NBP1-86442)

Learn more about PTMs related to BAG3 Antibody (NBP1-86442).

Blogs on BAG3

There are no specific blogs for BAG3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAG3