BAD-LAMP/LAMP5 Antibody

Images

 
Western Blot: BAD-LAMP/LAMP5 Antibody [NBP1-84246] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: BAD-LAMP/LAMP5 Antibody [NBP1-84246] - Staining of human colon shows distinct nuclear positivity in the basal portion of glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAD-LAMP/LAMP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Duodenum Lysate (NB820-60589)
Pancreas Lysate (NB820-60604)
A-431 Lysate (NBL1-26466)
Control Peptide
BAD-LAMP/LAMP5 Protein (NBP1-84246PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAD-LAMP/LAMP5 Antibody

  • BADLAMP
  • BAD-LAMP
  • C20orf103
  • chromosome 20 open reading frame 103
  • dJ1119D9.3
  • LAMP family protein C20orf103
  • LAMP5
  • LAMP-5
  • lysosomal-associated membrane protein family, member 5
  • UNC-43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
DDX0300P-100
Species: Hu, Ca
Applications: Flow, IHC, IHC-Fr, IHC-P, IP
AF873
Species: Hu
Applications: WB
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-88206
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-84246
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for BAD-LAMP/LAMP5 Antibody (NBP1-84246) (0)

There are no publications for BAD-LAMP/LAMP5 Antibody (NBP1-84246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAD-LAMP/LAMP5 Antibody (NBP1-84246) (0)

There are no reviews for BAD-LAMP/LAMP5 Antibody (NBP1-84246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAD-LAMP/LAMP5 Antibody (NBP1-84246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional BAD-LAMP/LAMP5 Products

Bioinformatics Tool for BAD-LAMP/LAMP5 Antibody (NBP1-84246)

Discover related pathways, diseases and genes to BAD-LAMP/LAMP5 Antibody (NBP1-84246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BAD-LAMP/LAMP5

There are no specific blogs for BAD-LAMP/LAMP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAD-LAMP/LAMP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMP5
Entrez