B4GALT5 Antibody


Western Blot: B4GALT5 Antibody [NBP1-69018] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

B4GALT5 Antibody Summary

Synthetic peptides corresponding to B4galt5 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5) The peptide sequence was selected from the C terminal of B4galt5. Peptide sequence GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDG
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B4galt5 and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B4GALT5 Antibody

  • B4Gal-T5
  • beta-1,4-galactosyltransferase 5
  • Beta-1,4-GalT II
  • beta-1,4-GalT IV
  • Beta-1,4-GalTase 5
  • beta-1.4-galactosyltransferase V
  • beta4-GalT IV
  • beta4Gal-T5
  • beta4GalT-V
  • EC 2.4.1.-
  • gt-V
  • MGC138470
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
  • UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5


B4galt5 is responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, Simple Western

Publications for B4GALT5 Antibody (NBP1-69018) (0)

There are no publications for B4GALT5 Antibody (NBP1-69018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALT5 Antibody (NBP1-69018) (0)

There are no reviews for B4GALT5 Antibody (NBP1-69018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALT5 Antibody (NBP1-69018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional B4GALT5 Products

Bioinformatics Tool for B4GALT5 Antibody (NBP1-69018)

Discover related pathways, diseases and genes to B4GALT5 Antibody (NBP1-69018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALT5 Antibody (NBP1-69018)

Discover more about diseases related to B4GALT5 Antibody (NBP1-69018).

Pathways for B4GALT5 Antibody (NBP1-69018)

View related products by pathway.

PTMs for B4GALT5 Antibody (NBP1-69018)

Learn more about PTMs related to B4GALT5 Antibody (NBP1-69018).

Blogs on B4GALT5

There are no specific blogs for B4GALT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our B4GALT5 Antibody and receive a gift card or discount.


Gene Symbol B4GALT5