B4GALT4 Recombinant Protein Antigen

Images

 
There are currently no images for B4GALT4 Protein (NBP2-14343PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

B4GALT4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human B4GALT4.

Source: E. coli

Amino Acid Sequence: AIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
B4GALT4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14343.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for B4GALT4 Recombinant Protein Antigen

  • B4Gal-T4
  • beta-1,4-galactosyltransferase 4
  • Beta-1,4-GalTase 4
  • beta4Gal-T4
  • beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4

Background

B4GALT4 is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88654
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NBP3-47896
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-38327
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-98903
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-94521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-42526
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-05805
Species: Hu
Applications: WB
NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-41994
Species: Hu
Applications: IHC, WB
NBP1-85786
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB

Publications for B4GALT4 Protein (NBP2-14343PEP) (0)

There are no publications for B4GALT4 Protein (NBP2-14343PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALT4 Protein (NBP2-14343PEP) (0)

There are no reviews for B4GALT4 Protein (NBP2-14343PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for B4GALT4 Protein (NBP2-14343PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B4GALT4 Products

Blogs on B4GALT4

There are no specific blogs for B4GALT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our B4GALT4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT4