B4GALNT2 Antibody - BSA Free

Western Blot: B4GALNT2 Antibody [NBP1-91229] - Analysis in human colon tissue.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human colon shows strong positivity in Golgi apparatus in glandular cells.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.

Analysis in human colon tissue.

• Reactivity: Hu, Mu, RM
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

B4GALNT2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: B4GALNT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID: 26435413).
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  B4GALNT2 Protein (NBP1-91229PEP)

Reactivity Notes

Rhesus Macaque reactivity reported in scientific literature (PMID: 24145553). Mouse reactivity reported in scientific literature (PMID: 26435413).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for B4GALNT2 Antibody - BSA Free

• 4 GalNAcT/Sda-GalNAcT
• B4GALNT2
• B4GALT
• beta 1,4 N-acetylgalactosaminyltransferase/betal
• beta-1,4 N-acetylgalactosaminyltransferase 2
• beta-1,4-N-acetyl-galactosaminyl transferase 2
• beta-4-N-acetylgalactosaminyltransferase
• GALGT2
• MGC142235
• MGC142237
• sd(a) beta-1,4-GalNAc transferase
• sda beta-1,4-GalNAc transferase
• UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for B4GALNT2 Antibody (NBP1-91229)(6)

Publications using NBP1-91229

• Yong Li, Yurong Cheng, Francesco Consolato, Guglielmo Schiano, Michael R. Chong, Maik Pietzner, Ngoc Quynh H. Nguyen, Nora Scherer, Mary L. Biggs, Marcus E. Kleber, Stefan Haug, Burulça Göçmen, Marie Pigeyre, Peggy Sekula, Inga Steinbrenner, Pascal Schlosser, Christina B. Joseph, Jennifer A. Brody, Morgan E. Grams, Caroline Hayward, Ulla T. Schultheiss, Bernhard K. Krämer, Florian Kronenberg, Annette Peters, Jochen Seissler, Dominik Steubl, Cornelia Then, Matthias Wuttke, Winfried März, Kai-Uwe Eckardt, Christian Gieger, Eric Boerwinkle, Bruce M. Psaty, Josef Coresh, Peter J. Oefner, Guillaume Pare, Claudia Langenberg, Jürgen E. Scherberich, Bing Yu, Shreeram Akilesh, Olivier Devuyst, Luca Rampoldi, Anna Köttgen Genome-wide studies reveal factors associated with circulating uromodulin and its relationships to complex diseases JCI Insight 2022-05-23 [PMID: 35446786]
• Beyersdorf JP, Bawage S, Iglesias N et al. Robust, Durable Gene Activation In Vivo via mRNA-Encoded Activators ACS nano 2022-03-31 [PMID: 35357116] (WB, Mouse)
• Sebastian A, Chang J, Mendez M et al. Comparative Transcriptomics Identifies Novel Genes and Pathways Involved in Post-Traumatic Osteoarthritis Development and Progression inflammation 2018-08-18 [PMID: 30205482] (IF/IHC, Mouse)
• Xu R, Singhal N, Serinagaoglu Y et al. Deletion of Galgt2 (B4Galnt2) reduces muscle growth in response to acute injury and increases muscle inflammation and pathology in dystrophin-deficient mice. Am J Pathol. 2015-10-01 [PMID: 26435413] (WB, Mouse)
• van der Post S, Hansson GC. Membrane Protein Profiling of Human Colon Reveals Distinct Regional Differences. Mol Cell Proteomics 2014-09-01 [PMID: 24889196] (IF/IHC, Human)
• Chicoine Louis G, Rodino-Klapac Louise R, Shao Guohong et al. Vascular delivery of rAAVrh74.MCK.GALGT2 to the gastrocnemius muscle of the rhesus macaque stimulates the expression of dystrophin and laminin alpha2 surrogates. Mol Ther. 2014-04-01 [PMID: 24145553] (Rhesus Macaque)

Bioinformatics

• Gene Symbol: B4GALNT2