B4GALNT2 Antibody

Western Blot: B4GALNT2 Antibody [NBP1-91229] - Analysis in human colon tissue.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human colon shows strong positivity in Golgi apparatus in glandular cells.

Immunohistochemistry-Paraffin: B4GALNT2 Antibody [NBP1-91229] - Staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.

• Reactivity: Hu, Mu, RM
• Applications: WB, IHC, IHC-Fr, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

B4GALNT2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: B4GALNT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in IHC-Frozen and WB reported in scientific literature (PMID: 26435413).
• Control Peptide:

  B4GALNT2 Protein (NBP1-91229PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24889196). Rhesus Macaque reactivity reported in scientific literature (PMID: 24145553). Mouse reactivity reported in scientific literature (PMID: 26435413).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for B4GALNT2 Antibody

• 4 GalNAcT/Sda-GalNAcT
• B4GALNT2
• B4GALT
• beta 1,4 N-acetylgalactosaminyltransferase/betal
• beta-1,4 N-acetylgalactosaminyltransferase 2
• beta-1,4-N-acetyl-galactosaminyl transferase 2
• beta-4-N-acetylgalactosaminyltransferase
• GALGT2
• MGC142235
• MGC142237
• sd(a) beta-1,4-GalNAc transferase
• sda beta-1,4-GalNAc transferase
• UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for B4GALNT2 Antibody (NBP1-91229)(5)

Publications using NBP1-91229

• Beyersdorf JP, Bawage S, Iglesias N et al. Robust, Durable Gene Activation In Vivo via mRNA-Encoded Activators ACS nano 2022-03-31 [PMID: 35357116] (WB, Mouse)
• Sebastian A, Chang J, Mendez M et al. Comparative Transcriptomics Identifies Novel Genes and Pathways Involved in Post-Traumatic Osteoarthritis Development and Progression inflammation 2018-08-18 [PMID: 30205482] (IHC, Mouse)
• Xu R, Singhal N, Serinagaoglu Y et al. Deletion of Galgt2 (B4Galnt2) reduces muscle growth in response to acute injury and increases muscle inflammation and pathology in dystrophin-deficient mice. Am J Pathol. 2015-10-01 [PMID: 26435413] (WB, Mouse)
• van der Post S, Hansson GC. Membrane Protein Profiling of Human Colon Reveals Distinct Regional Differences. Mol Cell Proteomics 2014-09-01 [PMID: 24889196] (IHC, Human)
• Chicoine Louis G, Rodino-Klapac Louise R, Shao Guohong et al. Vascular delivery of rAAVrh74.MCK.GALGT2 to the gastrocnemius muscle of the rhesus macaque stimulates the expression of dystrophin and laminin alpha2 surrogates. Mol Ther. 2014-04-01 [PMID: 24145553] (Rhesus Macaque)

Bioinformatics

• Gene Symbol: B4GALNT2