B3GALT6 Antibody


Western Blot: B3GALT6 Antibody [NBP1-69627] - This Anti-B3GALT6 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

B3GALT6 Antibody Summary

Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected from the N terminal of B3GALT6. Peptide sequence EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B3GALT6 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GALT6 Antibody

  • beta-1,3-galactosyltransferase 6
  • Beta-1,3-GalTase 6
  • beta3GalT6
  • beta3Gal-T6
  • EC
  • Galactosyltransferase II
  • Galactosylxylosylprotein 3-beta-galactosyltransferase
  • UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII
  • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6


B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for B3GALT6 Antibody (NBP1-69627) (0)

There are no publications for B3GALT6 Antibody (NBP1-69627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALT6 Antibody (NBP1-69627) (0)

There are no reviews for B3GALT6 Antibody (NBP1-69627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALT6 Antibody (NBP1-69627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional B3GALT6 Products

Bioinformatics Tool for B3GALT6 Antibody (NBP1-69627)

Discover related pathways, diseases and genes to B3GALT6 Antibody (NBP1-69627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on B3GALT6

There are no specific blogs for B3GALT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our B3GALT6 Antibody and receive a gift card or discount.


Gene Symbol B3GALT6