Home » AZI2 » AZI2 Antibodies » AZI2 Antibody

AZI2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: AZI2 Antibody [NBP1-88924] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunocytochemistry/ Immunofluorescence: AZI2 Antibody [NBP1-88924] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: AZI2 Antibody [NBP1-88924] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AZI2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQT
Specificity
Specificity of human AZI2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AZI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AZI2 Protein (NBP1-88924PEP)
Publications
Read Publication using NBP1-88924.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%). Reactivity reported in scientific literature (PMID: 23319410)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AZI2 Antibody

  • 5-azacytidine induced 2
  • AZ25-azacytidine-induced protein 2
  • FLJ21939
  • NAP15-azacytidine induced gene 2
  • NF-kappa-B-activating kinase-associated protein 1
  • TILPNak-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CACNA1A Antibody
NBP2-38049
Immunocytochemistry/Immunofluorescence: CACNA1A Antibody [NBP2-38049] - Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
WASF1/WAVE1
Antibody
AF5514
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, A172 human glioblastoma cell line, and 293T human embryonic kidney cell line, and mouse brain tissue. PVDF membrane was probed with 1 µg/mL of Human/Mouse WASF1/WAVE1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5514) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for WASF1/WAVE1 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu
Applications: WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - ACTR2 monoclonal antibody (M01), clone 1B10-C4 Analysis of ACTR2 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Analysis of monoclonal antibody to ACTR2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Western Blot analysis of ACTR2 expression in A-431 ( Cat # L015V1 ).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
TBK1 Antibody
(108A429)
NB100-56705
Western Blot: TBK1 Antibody (108A429) [NB100-56705] - Analysis using Azide and BSA Free version of NB100-56705. Lysate from 293 cells untransfected (lane 1) and transfected with human TBK1 cDNA (lane 2) probed with TBK1 antibody at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: TBK1 Antibody (108A429) [NB100-56705] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-TBK1 at 20 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Analysis using Azide and BSA Free version of NB100-56705. Staining on human testis (Formalin-Fixed Paraffin-Embedded (FFPE))
(1 Review)
(23 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NAP1L1 Antibody
NBP1-81162
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry: NAP1L1 Antibody [NBP1-81162] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western blot shows lysates of mouse uterus tissue and MEF mouse embryonic feeder cells. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse Angiopoietin‑like Protein 2/ANGPTL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1444) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Angiopoietin‑like Protein 2/ANGPTL2 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu
Applications: WB, IHC
AICDA Antibody
NBP1-30955
Western Blot: AICDA Antibody [NBP1-30955] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: AICDA Antibody [NBP1-30955] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: AICDA Antibody [NBP1-30955] - Paraffin-embedded mouse lymph node. AICDA antibody [N1N2], N-term dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Histone H2B
Antibody (4G6)
H00008349-M06
Immunohistochemistry-Paraffin: Histone H2B Antibody (4G6) [H00008349-M06] - Analysis of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. Antibody concentration 5 ug/ml
ELISA: Histone H2B Antibody (4G6) [H00008349-M06] - Detection limit for recombinant GST tagged HIST2H2BE is approximately 3ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC-P
BRICK1 Knockout
HeLa Cell Lysate
NBP2-65291
BRICK1 Knockout HeLa Cell Lysate
Species: Hu
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Rat pancreas stained with ODC1 Monoclonal Antibody (ODC1/485)
Flow Cytometry: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Flow Cytometry of human ODC1 on PC3 Cells. Black: cells alone: Grey isotype control: Green: AF488-labeled ODC1 Monoclonal Antibody (ODC1/485)
(1 Review)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NAP1L4 Antibody
NBP2-36543
Western Blot: NAP1L4 Antibody [NBP2-36543] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-NAP-2 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Species: Hu
Applications: WB, IP
NCKAP1 Antibody
NBP1-83269
Western Blot: NCKAP1 Antibody [NBP1-83269] - Analysis in control (vector only transfected HEK293T lysate) and nCKAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody shown in green.
Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining in human cerebral cortex and skeletal muscle tissues using anti-NCKAP1 antibody. Corresponding NCKAP1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Histone H2a
Antibody
NB100-56346
Western Blot: Histone H2a Antibody [NB100-56346] - Histone H2A in MCF-7 and HCT-116 cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Histone H2a Antibody [NB100-56346] - Human breast probed with Histone H2A antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Western Blot: Histone H2a Antibody [NB100-56346] - Analysis of Histone H2A in human PBMC lysate probed with Histone H2A antibody.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Recombinant Human
H2A Protein
H00008337-P01
SDS-Page: H2A Recombinant Protein [H00008337-P01]
Species: Hu
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.
Species: Hu
H4/n Antibody
(3E7D9)
NBP2-52487
Immunohistochemistry: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of paraffin-embedded esophageal cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Immunohistochemistry: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of paraffin-embedded colon cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Immunofluorescence: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of HeLa cells. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
IL-8/CXCL8 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(6 Reviews)
(81 Publications)
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
CYFIP1 Antibody
NBP2-16060
Western Blot: CYFIP1 Antibody [NBP2-16060] - Various tissue extracts (50 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with CYFIP1 antibody [N1N2], N-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CYFIP1 Antibody [NBP2-16060] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CYFIP1 stained by CYFIP1 antibody [N1N2], N-term diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: CYFIP1 Antibody [NBP2-16060] - Immunohistochemical analysis of paraffin-embedded Hepatoma, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
RPS4X Antibody
NBP1-82761
Immunohistochemistry-Paraffin: RPS4X Antibody [NBP1-82761] - RPS4Y1 Antibody [NBP1-82761] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
CYFIP2 Antibody
NBP2-57502
Immunocytochemistry/Immunofluorescence: CYFIP2 Antibody [NBP2-57502] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol.
Species: Hu
Applications: ICC/IF

Publications for AZI2 Antibody (NBP1-88924)(1)


Reviews for AZI2 Antibody (NBP1-88924) (0)

There are no reviews for AZI2 Antibody (NBP1-88924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AZI2 Antibody (NBP1-88924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AZI2 Antibody (NBP1-88924)

Discover related pathways, diseases and genes to AZI2 Antibody (NBP1-88924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AZI2 Antibody (NBP1-88924)

Discover more about diseases related to AZI2 Antibody (NBP1-88924).
 

Pathways for AZI2 Antibody (NBP1-88924)

View related products by pathway.

PTMs for AZI2 Antibody (NBP1-88924)

Learn more about PTMs related to AZI2 Antibody (NBP1-88924).

Blogs on AZI2

There are no specific blogs for AZI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AZI2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AZI2