AZI2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AZI2 Antibody [NBP1-88924] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: AZI2 Antibody [NBP1-88924] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AZI2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AZI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AZI2 Protein (NBP1-88924PEP)
Publications
Read Publication using NBP1-88924.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%). Reactivity reported in scientific literature (PMID: 23319410)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AZI2 Antibody

  • 5-azacytidine induced 2
  • AZ25-azacytidine-induced protein 2
  • FLJ21939
  • NAP15-azacytidine induced gene 2
  • NF-kappa-B-activating kinase-associated protein 1
  • TILPNak-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-57026
Species: Hu
Applications: ICC/IF
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP2-36543
Species: Hu
Applications: WB, IP
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP2-57502
Species: Hu
Applications: ICC/IF

Publications for AZI2 Antibody (NBP1-88924)(1)


Reviews for AZI2 Antibody (NBP1-88924) (0)

There are no reviews for AZI2 Antibody (NBP1-88924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AZI2 Antibody (NBP1-88924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AZI2 Products

Bioinformatics Tool for AZI2 Antibody (NBP1-88924)

Discover related pathways, diseases and genes to AZI2 Antibody (NBP1-88924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AZI2 Antibody (NBP1-88924)

Discover more about diseases related to AZI2 Antibody (NBP1-88924).
 

Pathways for AZI2 Antibody (NBP1-88924)

View related products by pathway.

PTMs for AZI2 Antibody (NBP1-88924)

Learn more about PTMs related to AZI2 Antibody (NBP1-88924).

Blogs on AZI2

There are no specific blogs for AZI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AZI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AZI2