Home » AZI2 » AZI2 Antibodies » AZI2 Antibody

AZI2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: AZI2 Antibody [NBP1-88924] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: AZI2 Antibody [NBP1-88924] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AZI2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQT
Specificity
Specificity of human AZI2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AZI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AZI2 Protein (NBP1-88924PEP)
Publications
Read Publication using NBP1-88924.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%). Reactivity reported in scientific literature (PMID: 23319410)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AZI2 Antibody

  • 5-azacytidine induced 2
  • AZ25-azacytidine-induced protein 2
  • FLJ21939
  • NAP15-azacytidine induced gene 2
  • NF-kappa-B-activating kinase-associated protein 1
  • TILPNak-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

WASF1/WAVE1
Antibody
AF5514
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, A172 human glioblastoma cell line, and 293T human embryonic kidney cell line, and mouse brain tissue. PVDF membrane was probed with 1 µg/mL of Human/Mouse WASF1/WAVE1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5514) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for WASF1/WAVE1 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu
Applications: WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - ACTR2 monoclonal antibody (M01), clone 1B10-C4 Analysis of ACTR2 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Analysis of monoclonal antibody to ACTR2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Western Blot analysis of ACTR2 expression in A-431 ( Cat # L015V1 ).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
TBK1 Antibody
(108A429)
NB100-56705
Western Blot: TBK1 Antibody (108A429) [NB100-56705] - Analysis using Azide and BSA Free version of NB100-56705. Lysate from 293 cells untransfected (lane 1) and transfected with human TBK1 cDNA (lane 2) probed with TBK1 antibody at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: TBK1 Antibody (108A429) [NB100-56705] - Antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). A dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Immunohistochemistry: TBK1 Antibody (108A429) - Azide and BSA Free [NBP2-33243] - Staining on human testis (Formalin-Fixed Paraffin-Embedded (FFPE)) Image from the Azide and BSA Free version of this antibody.
(1 Review)
(26 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NAP1L1 Antibody
NBP1-81162
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western blot shows lysates of mouse uterus tissue and MEF mouse embryonic feeder cells. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse Angiopoietin‑like Protein 2/ANGPTL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1444) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Angiopoietin‑like Protein 2/ANGPTL2 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu
Applications: WB, IHC
AICDA Antibody
NBP1-30955
Western Blot: AICDA Antibody [NBP1-30955] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: AICDA Antibody [NBP1-30955] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: AICDA Antibody [NBP1-30955] - Paraffin-embedded mouse lymph node. AICDA antibody [N1N2], N-term dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
BRICK1 Antibody
NBP3-03514
Immunocytochemistry/Immunofluorescence: BRICK1 Antibody [NBP3-03514] - Analysis of U-2 OS cells using BRICK1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: BRICK1 Antibody [NBP3-03514] - Paraffin-embedded human breast cancer using BRICK1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: BRICK1 Antibody [NBP3-03514] - Paraffin-embedded human stomach using BRICK1 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu
Applications: ICC/IF, IHC
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate
Immunocytochemistry/Immunofluorescence: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - IF staining of LNCap cells using AF488 labeled ODC1 Monoclonal Antibody (ODC1/485) (GREEN) DAPI was used to stain the cell nucleus (blue). Image using the Azide and BSA Free format of this antibody.
Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with Ornithine Decarboxylase Antibody (ODC1/485).
(1 Review)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NAP1L4 Antibody
NBP2-36543
Western Blot: NAP1L4 Antibody [NBP2-36543] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-NAP-2 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: NAP1L4 Antibody [NBP2-36543] - Detection of human NAP-2 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-NAP-2 antibody NBP2-36543 used for IP at 6 ug per reaction. NAP-2 was also immunoprecipitated by rabbit anti-NAP-2 antibody NBP2-36542. For blotting immunoprecipitated NAP-2, NBP2-36543 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Hu
Applications: WB, IP
NCKAP1 Antibody
NBP1-32339
Western Blot: NCKAP1 Antibody [NBP1-32339] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NCKAP1 antibody [C1C2], Internal diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry Whole-Mount: NCKAP1 Antibody [NBP1-32339] - NCKAP1 antibody [C1C2], Internal detects NCKAP1 protein by immunohistochemical analysis. Sample: Frozen-sectioned mouse cerebellum. Green: NCKAP1 stained by NCKAP1 antibody [C1C2], Internal diluted at 1:250. Red: NF-H, stained by NF-H antibody [GT114] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: NCKAP1 Antibody [NBP1-32339] - Sample (50 ug of whole cell lysate) A: Mouse brain 5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-WhMt
Histone H2a
Antibody
NB100-56346
Western Blot: Histone H2a Antibody [NB100-56346] - Histone H2A in MCF-7 and HCT-116 cells. Image from verified customer review.
Immunohistochemistry-Paraffin: Histone H2a Antibody [NB100-56346] - Human breast probed with Histone H2A antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Western Blot: Histone H2a Antibody [NB100-56346] - Analysis of Histone H2A in human PBMC lysate probed with Histone H2A antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
H2A Antibody
NBP1-58095
Western Blot: H2A Antibody [NBP1-58095] - Jurkat cell lysate, concentration 2.5 ug/ml.
Species: Hu
Applications: WB
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.
Species: Hu
H4/n Antibody
(3E7H2)
NBP2-52486
Western Blot: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis using HIST2H4A(20Me) mouse mAb against THP-1 (1) cell lysate.
Immunocytochemistry/Immunofluorescence: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of HeLa cells using HIST2H4A(20Me) mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Immunohistochemistry-Paraffin: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of paraffin-embedded stomach cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
IL-8/CXCL8 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(8 Reviews)
(93 Publications)
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
CYFIP1 Antibody
NBP2-16060
Western Blot: CYFIP1 Antibody [NBP2-16060] - Various tissue extracts (50 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with CYFIP1 antibody [N1N2], N-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CYFIP1 Antibody [NBP2-16060] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CYFIP1 stained by CYFIP1 antibody [N1N2], N-term diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: CYFIP1 Antibody [NBP2-16060] - Immunohistochemical analysis of paraffin-embedded Hepatoma, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
RPS4X Antibody
NBP2-94118
Western Blot: RPS4X Antibody [NBP2-94118] - Analysis of extracts of various cell lines, using RPS4X at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: RPS4X Antibody [NBP2-94118] - Paraffin-embedded human kidney using RPS4X.
Species: Hu, Mu, Rt
Applications: WB, IHC
Recombinant Human
CYFIP2 GST (N-Term) P ...
H00026999-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu

Publications for AZI2 Antibody (NBP1-88924)(1)


Reviews for AZI2 Antibody (NBP1-88924) (0)

There are no reviews for AZI2 Antibody (NBP1-88924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AZI2 Antibody (NBP1-88924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional AZI2 Products

Bioinformatics Tool for AZI2 Antibody (NBP1-88924)

Discover related pathways, diseases and genes to AZI2 Antibody (NBP1-88924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AZI2 Antibody (NBP1-88924)

Discover more about diseases related to AZI2 Antibody (NBP1-88924).
 

Pathways for AZI2 Antibody (NBP1-88924)

View related products by pathway.

PTMs for AZI2 Antibody (NBP1-88924)

Learn more about PTMs related to AZI2 Antibody (NBP1-88924).

Blogs on AZI2

There are no specific blogs for AZI2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AZI2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AZI2