AZI2 Antibody (4Q9V9)

Western Blot: AZI2 Antibody (4Q9V9) [NBP3-33293] - Western blot analysis of various lysates using AZI2 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 4Q9V9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

AZI2 Antibody (4Q9V9) Summary

• Description: Novus Biologicals Rabbit AZI2 Antibody (4Q9V9) (NBP3-33293) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant protein containing a sequence corresponding to amino acids 282-387 of human AZI2 (NP_071906.1).
  
  Sequence:
  YTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWVFPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQN
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: AZI2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AZI2 Antibody (4Q9V9)

• 5-azacytidine induced 2
• AZ25-azacytidine-induced protein 2
• FLJ21939
• NAP15-azacytidine induced gene 2
• NF-kappa-B-activating kinase-associated protein 1
• TILPNak-associated protein 1

Background

AZI2, or NAP1, contributes to the activation of NFKB (see MIM 164011)-dependent gene expression by activating IKK-related kinases, such as NAK (TBK1; MIM 604834) (Fujita et al., 2003 [PubMed 14560022]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AZI2