Axotrophin Antibody (2B9)

Western Blot: Axotrophin Antibody (2B9) [H00064844-M01] - MARCH7 monoclonal antibody (M01), clone 2B9 Analysis of MARCH7expression in K-562.

Immunocytochemistry/Immunofluorescence: Axotrophin Antibody (2B9) [H00064844-M01] - Analysis of monoclonal antibody to MARCH7 on HeLa cell. Antibody concentration 10 ug/ml.

ELISA: Axotrophin Antibody (2B9) [H00064844-M01] - Detection limit for recombinant GST tagged MARCH7 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 2B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Axotrophin Antibody (2B9) Summary

• Immunogen: MARCH7 (NP_073737, 66 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG
• Specificity: MARCH7 (2B9)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MARCH7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Axotrophin Antibody (2B9)

• AXO
• AXOT
• Axotrophin
• E3 ubiquitin-protein ligase MARCH7
• EC 6.3.2
• EC 6.3.2.-
• MARCH-VIIDKFZp586F1122
• membrane-associated ring finger (C3HC4) 7
• Membrane-associated RING finger protein 7
• Membrane-associated RING-CH protein VII
• RING finger protein 177
• RNF177axotrophin

Background

E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligasesaccept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer theubiquitin to targeted substrates

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARCH7
• Entrez:
  • 64844(Human)
• Uniprot:
  • NP_073737(Human)