Axotrophin Antibody (2B9)

Images

 
Western Blot: Axotrophin Antibody (2B9) [H00064844-M01] - MARCH7 monoclonal antibody (M01), clone 2B9 Analysis of MARCH7expression in K-562.
Immunocytochemistry/ Immunofluorescence: Axotrophin Antibody (2B9) [H00064844-M01] - Analysis of monoclonal antibody to MARCH7 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Axotrophin Antibody (2B9) [H00064844-M01] - Detection limit for recombinant GST tagged MARCH7 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Axotrophin Antibody (2B9) Summary

Immunogen
MARCH7 (NP_073737, 66 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG
Specificity
MARCH7 (2B9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MARCH7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Axotrophin Antibody (2B9)

  • AXO
  • AXOT
  • Axotrophin
  • E3 ubiquitin-protein ligase MARCH7
  • EC 6.3.2
  • EC 6.3.2.-
  • MARCH-VIIDKFZp586F1122
  • membrane-associated ring finger (C3HC4) 7
  • Membrane-associated RING finger protein 7
  • Membrane-associated RING-CH protein VII
  • RING finger protein 177
  • RNF177axotrophin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7734-LF
Species: Hu
Applications: BA
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008615-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
MAB5696
Species: Hu, Mu
Applications: WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
AF-249-NA
Species: Hu
Applications: Neut, WB
NBP2-15374
Species: Hu
Applications: Func, IHC, IHC-P, In vitro, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB6609
Species: Hu, Mu
Applications: IHC, WB
NBP2-13780
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Axotrophin Antibody (H00064844-M01) (0)

There are no publications for Axotrophin Antibody (H00064844-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Axotrophin Antibody (H00064844-M01) (0)

There are no reviews for Axotrophin Antibody (H00064844-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Axotrophin Antibody (H00064844-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Axotrophin Products

Bioinformatics Tool for Axotrophin Antibody (H00064844-M01)

Discover related pathways, diseases and genes to Axotrophin Antibody (H00064844-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axotrophin Antibody (H00064844-M01)

Discover more about diseases related to Axotrophin Antibody (H00064844-M01).
 

Pathways for Axotrophin Antibody (H00064844-M01)

View related products by pathway.

Research Areas for Axotrophin Antibody (H00064844-M01)

Find related products by research area.

Blogs on Axotrophin

There are no specific blogs for Axotrophin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Axotrophin Antibody (2B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH7
Entrez
Uniprot