Atrial Natriuretic Peptide/ANP Antibody

Images

 
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-34105] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-34105] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-34105] - Staining in human heart muscle and skeletal muscle tissues using anti-NPPA antibody. Corresponding NPPA ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Atrial Natriuretic Peptide/ANP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT
Specificity
Specificity of human Atrial Natriuretic Peptide/ANP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPPA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Atrial Natriuretic Peptide/ANP Antibody

  • ANF
  • ANP
  • ANPatriopeptin
  • ATFB6
  • atrial natriuretic factor
  • Atrial Natriuretic Peptide
  • Cardionatrin
  • CDD-ANF
  • natriuretic peptide A
  • natriuretic peptide precursor A
  • NPPA
  • PND
  • PNDcardionatrin
  • prepronatriodilatin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46201
Species: Hu
Applications: WB, IHC
NBP1-31559
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66986
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67339
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP1-31365
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
H00004882-M02
Species: Hu, Po
Applications: WB, ELISA, IHC-P

Publications for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105) (0)

There are no publications for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105) (0)

There are no reviews for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Atrial Natriuretic Peptide/ANP Products

Bioinformatics Tool for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105)

Discover related pathways, diseases and genes to Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105)

Discover more about diseases related to Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105).
 

Pathways for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105)

View related products by pathway.

PTMs for Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105)

Learn more about PTMs related to Atrial Natriuretic Peptide/ANP Antibody (NBP2-34105).

Blogs on Atrial Natriuretic Peptide/ANP

There are no specific blogs for Atrial Natriuretic Peptide/ANP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Atrial Natriuretic Peptide/ANP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPPA
Uniprot