Recombinant Human ATP6V1C2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ATP6V1C2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 188-253 of Human ATP6V1C2

Source: Wheat Germ

Amino Acid Sequence: VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP6V1C2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP6V1C2 Protein

  • ATP6C2
  • ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
  • Vacuolar proton pump subunit C 2
  • V-ATPase C2 subunit
  • V-ATPase subunit C 2
  • VMA5
  • V-type proton ATPase subunit C 2

Background

ATP6V1C2 - ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00028299-P01
Species: Hu
MAB1936
Species: Hu
Applications: WB, IP
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33982
Species: Hu
Applications: IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00580
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88894
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49059
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-89331
Species: Hu
Applications: IHC, IHC-P
NBP1-85668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00245973-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01) (0)

There are no publications for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01) (0)

There are no reviews for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01)

Discover related pathways, diseases and genes to ATP6V1C2 Partial Recombinant Protein (H00245973-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01)

Discover more about diseases related to ATP6V1C2 Partial Recombinant Protein (H00245973-Q01).
 

Pathways for ATP6V1C2 Partial Recombinant Protein (H00245973-Q01)

View related products by pathway.

Blogs on ATP6V1C2

There are no specific blogs for ATP6V1C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP6V1C2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1C2