Recombinant Human ATP6V1C1 Protein

Images

 
SDS-Page: Recombinant Human ATP6V1C1 Protein [H00000528-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATP6V1C1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-382 of Human ATP6V1C1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ATP6V1C1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP6V1C1 Protein

  • ATP6CH+-transporting ATPase chain C, vacuolar
  • ATP6Dsubunit C of vacuolar proton-ATPase V1 domain
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
  • FLJ20057
  • H(+)-transporting two-sector ATPase, subunit C
  • vacuolar ATP synthase subunit C
  • vacuolar proton pump C subunit
  • Vacuolar proton pump subunit C 1
  • vacuolar proton pump, 42-kD subunit
  • vacuolar proton-ATPase, subunit C, VI domain
  • VATCH+ -ATPase C subunit
  • V-ATPase C subunit
  • V-ATPase subunit C 1
  • Vma5
  • V-type proton ATPase subunit C 1

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00028299-P01
Species: Hu
NBP2-00580
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88890
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-49059
Species: Hu
Applications: WB, IHC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
H00000533-R02
Species: Hu
NBP2-14335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-55232
Species: Hu
Applications: WB, ICC/IF
NBL1-07836
Species: Hu
NBP1-88894
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46556
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
H00000528-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ATP6V1C1 Recombinant Protein (H00000528-P01) (0)

There are no publications for ATP6V1C1 Recombinant Protein (H00000528-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1C1 Recombinant Protein (H00000528-P01) (0)

There are no reviews for ATP6V1C1 Recombinant Protein (H00000528-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1C1 Recombinant Protein (H00000528-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V1C1 Products

Bioinformatics Tool for ATP6V1C1 Recombinant Protein (H00000528-P01)

Discover related pathways, diseases and genes to ATP6V1C1 Recombinant Protein (H00000528-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1C1 Recombinant Protein (H00000528-P01)

Discover more about diseases related to ATP6V1C1 Recombinant Protein (H00000528-P01).
 

Pathways for ATP6V1C1 Recombinant Protein (H00000528-P01)

View related products by pathway.

Blogs on ATP6V1C1

There are no specific blogs for ATP6V1C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RFC4 Antibody
NB100-233

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP6V1C1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1C1