Recombinant Human ATP2C1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ATP2C1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 119-269 of Human ATP2C1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP2C1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
42.35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP2C1 GST (N-Term) Protein

  • ATPase, Ca++ transporting, type 2C, member 1
  • BCPM
  • benign chronic pemphigus (Hailey-Hailey disease)
  • Ca(2+)-sequestering
  • calcium-transporting ATPase type 2C member 1
  • EC 3.6.3
  • HHD
  • hSPCA1
  • HUSSY-28
  • PMR1L
  • secretory pathway Ca2+/Mn2+ ATPase 1

Background

The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF2338
Species: Hu
Applications: ICC, IP, WB
NBP1-76567
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
1129-ER
Species: Hu
Applications: BA
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB120-3529
Species: Hu, Po, Rt
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
NBP3-12260
Species: Bv, Mu, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-79775
Species: Hu
Applications: IHC, IHC-P, PA, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP2-99299
Species: Hu
Applications: ICC/IF, WB
NB300-569
Species: Am, Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
H00027032-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ATP2C1 Partial Recombinant Protein (H00027032-Q01) (0)

There are no publications for ATP2C1 Partial Recombinant Protein (H00027032-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP2C1 Partial Recombinant Protein (H00027032-Q01) (0)

There are no reviews for ATP2C1 Partial Recombinant Protein (H00027032-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP2C1 Partial Recombinant Protein (H00027032-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP2C1 Products

Bioinformatics Tool for ATP2C1 Partial Recombinant Protein (H00027032-Q01)

Discover related pathways, diseases and genes to ATP2C1 Partial Recombinant Protein (H00027032-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP2C1 Partial Recombinant Protein (H00027032-Q01)

Discover more about diseases related to ATP2C1 Partial Recombinant Protein (H00027032-Q01).
 

Pathways for ATP2C1 Partial Recombinant Protein (H00027032-Q01)

View related products by pathway.

PTMs for ATP2C1 Partial Recombinant Protein (H00027032-Q01)

Learn more about PTMs related to ATP2C1 Partial Recombinant Protein (H00027032-Q01).
 

Research Areas for ATP2C1 Partial Recombinant Protein (H00027032-Q01)

Find related products by research area.

Blogs on ATP2C1

There are no specific blogs for ATP2C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP2C1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2C1